SecReT6
Protein ID: 374331205
SecReT6 ID534
T6SS typei3
Gene symbolsciE
Locus tagPSE_2859
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3055528..3056379 [-]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDG8PSQ4
KEGG IDpsf:PSE_2859
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.20E-34, Aligned region: 137..255
Protein Sequence: 283 a.a.     [Download]
>gi|374331205|ref|YP_005081389.1| virulence protein, SciE type [Pseudovibrio sp. FO-BEG1]
MPAKEHLATGNLKEALEITQEQVRKNPEDVKERILLFQLYCVNGDWLKAKKQLPIIRQFDDSAIPMVETY
SRLLDMEQLREEVFAGVKTPLLFGEPKEWLSFLIQALKFDVEKNEQAAVELRDQAFEEAEAISGTINGEK
FEWLADADPRLGPVLELMMSNAYYWVPYSAIKSIRIPEPRDLRDMCWTPVNLLWVNGGPANGFIPTRYVE
TVHSDDANLKLSRLTSWDGDRPIGQRMFAHETSEIPLLEVRSINFDTQVDVHKDIGPVVGSGDTTTSTEG
GHG
 
Nucleotide Sequence: 852 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3056379-3055528 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGCCTGCGAAGGAACATCTAGCCACAGGTAACCTGAAAGAAGCACTCGAAATCACTCAGGAGCAAGTGC
GAAAAAATCCTGAGGACGTCAAAGAGCGTATCCTCCTCTTCCAGCTCTATTGTGTGAACGGAGACTGGTT
GAAGGCTAAAAAACAACTTCCAATCATTCGACAGTTTGATGATAGCGCCATTCCTATGGTGGAGACATAC
TCTCGTTTACTCGATATGGAGCAACTGCGTGAGGAAGTCTTTGCAGGTGTAAAGACCCCTCTTCTGTTTG
GCGAACCCAAAGAGTGGCTTTCCTTTCTTATCCAGGCGCTGAAGTTCGACGTTGAAAAGAACGAACAAGC
CGCCGTAGAGCTTCGTGATCAGGCTTTTGAGGAAGCAGAAGCGATCTCAGGGACCATCAACGGCGAAAAG
TTTGAATGGCTCGCTGACGCCGATCCCCGTTTAGGTCCAGTTTTAGAGCTCATGATGAGCAATGCCTATT
ATTGGGTTCCTTACTCAGCCATCAAATCCATCCGAATTCCTGAGCCACGTGACTTAAGAGATATGTGCTG
GACACCAGTCAATCTCCTCTGGGTCAACGGCGGACCTGCAAATGGTTTCATTCCAACACGTTACGTGGAA
ACCGTGCATTCCGATGATGCCAATCTGAAACTTTCTCGCCTTACCTCATGGGACGGAGACAGACCAATTG
GGCAGCGCATGTTTGCGCATGAGACATCCGAAATCCCACTTCTTGAGGTCCGTTCAATCAACTTTGACAC
TCAAGTAGACGTTCACAAGGACATTGGTCCTGTCGTGGGTAGCGGCGATACTACTACTTCAACGGAGGGC
GGCCATGGCTGA