SecReT6
Protein ID: 374331206
SecReT6 ID534
T6SS typei3
Gene symbolsciM
Locus tagPSE_2860
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3056463..3056993 [-]
ProductSciM protein
NoteTssD
UniProt IDG8PSQ5
KEGG IDpsf:PSE_2860
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-26, Aligned region: 10..148
Protein Sequence: 176 a.a.     [Download]
>gi|374331206|ref|YP_005081390.1| SciM protein [Pseudovibrio sp. FO-BEG1]
MAIDAYVIFEGPGAGAIAIEGETQDDEMAKKKAFEITTFSMGAENTMDIGSMRGGSGAGRVKFKEFQIEK
KSDRGSPGLFLACCNGGIYKTVTLILRRSGGASGKSGVIFLTFTMKLVAIKEISWEGNDEECKESIQMEY
GAVEINYTMMDTTGAMGKTLTEKWSRIKNTRDLAVE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3056993-3056463 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGCAATTGATGCATATGTAATCTTCGAGGGGCCCGGTGCCGGTGCTATCGCCATTGAAGGCGAAACAC
AAGATGACGAAATGGCCAAGAAAAAGGCTTTCGAAATCACCACTTTCAGCATGGGTGCTGAAAACACTAT
GGACATCGGTTCCATGCGTGGTGGTTCTGGTGCCGGCCGCGTGAAGTTTAAAGAATTCCAGATTGAAAAG
AAAAGTGATCGCGGTTCGCCTGGGCTCTTCCTCGCTTGTTGTAACGGCGGTATCTACAAAACGGTTACCT
TAATTCTCCGTCGTTCAGGTGGTGCATCCGGTAAGTCAGGTGTGATCTTCCTCACCTTCACCATGAAGCT
GGTTGCTATCAAAGAAATCAGCTGGGAAGGCAACGACGAAGAGTGTAAAGAATCCATCCAGATGGAATAT
GGTGCCGTAGAGATAAATTACACCATGATGGATACCACTGGTGCGATGGGCAAGACACTTACAGAAAAGT
GGAGCCGCATCAAGAATACTCGCGACCTCGCCGTGGAATAG