SecReT6
Protein ID: 374331207
SecReT6 ID534
T6SS typei3
Gene symbolsciI
Locus tagPSE_2861
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3057127..3058632 [-]
ProductCytoplasmic protein SciI
NoteTssC
UniProt IDG8PSQ6
KEGG IDpsf:PSE_2861
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.60E-197, Aligned region: 70..496
Protein Sequence: 501 a.a.     [Download]
>gi|374331207|ref|YP_005081391.1| Cytoplasmic protein SciI [Pseudovibrio sp. FO-BEG1]
MAEAEKQPEVEAEEAQVEAIDPNNFESLLKQEFKPKSDSAKEAVEGAVATLAEQALANTTLISDDTLKSI
EAIVAEIDKKLSEQMQQILHHEDFQSLEGTWRGLHYLVNNTETDEMLKIRVMNISKKDLSKTLKKYKGTA
WDQSPVFKKIYEEEYGQFGGEPYGVLIGDYYFDHTPPDVALLNEMAEIAAAAHAPFIAGASPTLFQMESW
QELSNPRDLTKIFQTPEYAAWRSLREAEDSRYIGLAMPRFLARLPYGPNTEPVEEFDFEEDTSGADSKKY
VWSNSAFAMATNITRSFKMYGWCSRIRGVESGGAVEGLPAHTFPTDDGGVDMKCPTEIAITDRREAELAK
NGMMPLLHRKNSDLAAFIGAQSLQKPAEYTDPDATANANLAARLPYLFASCRFAHYLKCIVRDKIGSFKE
RQDLQNWLQDWIMRYVDGDPAGSSEQTKAEKPLASAEVVVEADDSNPGYYSAKFFLRPHYQLEGLTVSLR
LVSKLPSAKGG
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3058632-3057127 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGCTGAAGCTGAAAAACAACCGGAAGTCGAAGCCGAAGAGGCGCAGGTTGAAGCTATTGATCCCAATA
ACTTTGAATCTCTTCTCAAACAGGAATTCAAGCCAAAATCAGACAGTGCTAAAGAAGCCGTAGAAGGCGC
AGTGGCAACGCTGGCCGAACAGGCTTTGGCAAACACAACACTGATTTCGGATGATACGCTTAAGTCGATT
GAAGCAATCGTTGCTGAGATAGACAAGAAACTCTCTGAGCAGATGCAGCAAATCCTTCACCACGAAGATT
TCCAGAGCCTGGAAGGTACGTGGCGCGGTCTGCATTATCTCGTCAACAACACTGAAACTGACGAGATGCT
GAAGATCCGGGTGATGAACATCTCAAAGAAAGACCTCAGCAAAACCCTGAAGAAGTATAAGGGTACTGCT
TGGGACCAGAGCCCGGTCTTCAAGAAGATCTACGAAGAAGAATATGGCCAGTTTGGCGGCGAACCTTATG
GCGTGCTGATCGGTGATTACTATTTCGATCACACCCCGCCAGATGTGGCTCTTCTCAATGAGATGGCTGA
GATTGCTGCGGCGGCACATGCTCCCTTCATTGCCGGTGCCAGCCCTACTCTCTTCCAGATGGAATCCTGG
CAAGAACTTTCCAACCCTCGCGATCTCACCAAAATCTTCCAGACACCAGAATATGCCGCATGGCGGTCCC
TGCGTGAAGCCGAAGACTCTCGCTATATTGGCCTTGCAATGCCGCGTTTCCTGGCTCGTTTGCCTTATGG
GCCAAATACGGAGCCGGTGGAAGAATTCGACTTTGAAGAAGACACCTCAGGTGCTGATTCAAAGAAATAC
GTCTGGTCCAATTCAGCGTTTGCGATGGCGACCAACATCACAAGATCCTTCAAGATGTATGGCTGGTGTT
CCCGTATCCGCGGTGTTGAATCTGGTGGTGCTGTTGAAGGACTGCCTGCTCACACCTTCCCAACGGATGA
TGGCGGCGTGGACATGAAGTGTCCAACCGAGATTGCGATCACTGACCGACGCGAGGCGGAGCTTGCAAAG
AATGGCATGATGCCATTGCTACACCGCAAGAATTCGGACCTAGCTGCGTTCATCGGCGCACAGTCTTTGC
AAAAACCTGCAGAGTATACAGATCCGGATGCGACAGCAAATGCCAACCTTGCAGCTAGGTTACCTTACTT
ATTTGCAAGTTGTCGGTTCGCTCACTATCTAAAATGTATTGTTCGGGACAAGATTGGCTCGTTCAAAGAA
CGTCAGGATTTACAGAACTGGCTTCAGGATTGGATCATGCGTTACGTAGATGGCGATCCTGCAGGTTCCA
GTGAACAGACCAAGGCAGAAAAACCCTTGGCATCGGCTGAAGTAGTCGTTGAAGCAGACGATTCAAACCC
AGGCTACTACAGCGCGAAGTTCTTCCTGCGTCCGCATTACCAGCTGGAAGGACTGACTGTGTCCTTGCGA
CTGGTTTCAAAACTTCCGTCAGCCAAGGGAGGTTAA