SecReT6
Protein ID: 374331208
SecReT6 ID534
T6SS typei3
Gene symbolsciH
Locus tagPSE_2862
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3058625..3059047 [-]
ProductCytoplasmic protein SciH
NoteTssB
UniProt IDG8PSQ7
KEGG IDpsf:PSE_2862
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.70E-46, Aligned region: 3..126
Protein Sequence: 140 a.a.     [Download]
>gi|374331208|ref|YP_005081392.1| Cytoplasmic protein SciH [Pseudovibrio sp. FO-BEG1]
MAGVMADLSGKPEDPLPPVGDRKALEIDVDNFDERMKSMKPRVAFRVPNTLTGEGNLSVDLTFESMDDFS
PAAVARKVDALRTLLEARTQLANLMTYMDGKSGAEELIGKVLNDPALLQTLAAAPKEGDAAAEEKDENNG
 
Nucleotide Sequence: 423 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3059047-3058625 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
GTGGCTGGCGTTATGGCTGACCTTTCAGGCAAGCCAGAAGATCCGCTTCCTCCTGTAGGAGATCGAAAAG
CTCTCGAAATTGACGTAGACAATTTTGATGAACGTATGAAGTCTATGAAGCCGCGTGTTGCGTTCCGTGT
TCCCAACACACTTACGGGTGAAGGCAATCTCAGCGTTGATCTGACATTTGAGAGCATGGACGATTTCTCG
CCCGCAGCGGTCGCACGCAAAGTTGATGCCTTACGCACTCTACTTGAAGCCCGCACACAGCTCGCAAACC
TGATGACCTATATGGACGGCAAGTCCGGTGCCGAGGAGTTGATCGGCAAGGTTTTGAATGATCCTGCCCT
TTTGCAAACACTAGCAGCCGCACCGAAGGAAGGTGATGCTGCTGCTGAAGAGAAGGACGAGAATAATGGC
TGA