SecReT6
Protein ID: 374331209
SecReT6 ID534
T6SS typei3
Gene symbolimpA
Locus tagPSE_2863
StrainPseudovibrio sp. FO-BEG1
Repliconchromosome [GenBank: NC_016642] [Browse all T6SS(s) in this replicon]
Location [Strand]3059201..3060247 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDG8PSQ8
KEGG IDpsf:PSE_2863
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-17, Aligned region: 52..112
Protein Sequence: 348 a.a.     [Download]
>gi|374331209|ref|YP_005081393.1| ImpA domain-containing protein [Pseudovibrio sp. FO-BEG1]
MDPTASLQPIEENAPCGPDLEYDPDFLTMETAASGTQDHQIGEAIIKGEEPDWKEALRLSTQLLTRTYDL
RVAIIHAQSLIAIEGFPGFAKSMEFIAQMLDTFWDTLHPELDPAEGHDPIMRANVLSALNDRRTTLTLLR
NTALVQSRIFGTWSLNEIAIARGETELPEGRDRPDIASYDAALRETDRENIAEVVNAIETAIKTSEHVRD
FFAQHGGLILDDLLRELRQAQFLLAPALELEEEEDEEDEESSSEEEGAVKARSGKKSASFTGTVINRTDV
LRALDEVCAYYKRSEPSSPVPLLLGRARRLVDLDFYSIIKDLAPDGEAQVLNIRGSRPEDDDEHGSID
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|374328350|ref|NC_016642.1|:c3060247-3059201 Pseudovibrio sp. FO-BEG1 chromosome, complete genome
ATGGATCCAACGGCTTCCCTTCAACCTATTGAGGAGAACGCACCTTGCGGGCCGGATCTTGAGTACGATC
CTGACTTCCTGACGATGGAAACTGCTGCCAGTGGCACCCAGGATCACCAGATCGGGGAAGCCATTATCAA
GGGTGAAGAGCCCGACTGGAAGGAAGCGCTCCGTCTTTCAACGCAGCTGCTCACCAGAACCTATGATCTT
CGGGTTGCCATAATCCATGCACAGTCACTAATTGCAATCGAAGGCTTTCCAGGTTTCGCCAAAAGCATGG
AATTCATTGCACAAATGCTGGATACCTTCTGGGATACTCTGCACCCGGAATTAGATCCGGCTGAGGGGCA
TGACCCCATCATGCGTGCCAATGTCTTGTCTGCTCTCAATGACAGGCGCACAACCCTCACGTTGCTCCGA
AACACTGCCTTGGTGCAGTCGCGCATCTTCGGGACTTGGTCACTCAACGAAATTGCGATCGCACGCGGTG
AGACAGAATTGCCTGAAGGTCGCGACCGACCAGATATCGCTTCCTATGATGCAGCCCTCAGGGAGACAGA
TCGCGAAAACATTGCAGAGGTCGTTAATGCAATCGAAACCGCGATCAAAACATCTGAGCACGTTCGCGAT
TTCTTCGCCCAACATGGTGGCCTGATCCTTGATGATCTACTGCGAGAGTTGCGGCAGGCCCAGTTTTTAT
TGGCTCCAGCCTTGGAGTTGGAAGAGGAGGAGGACGAAGAAGACGAGGAATCTTCCTCTGAGGAAGAAGG
TGCAGTTAAAGCCCGTTCCGGCAAGAAAAGCGCAAGTTTTACCGGAACAGTTATAAACCGAACTGACGTG
TTAAGGGCTCTTGATGAAGTTTGTGCGTATTACAAGCGTAGTGAACCTTCAAGTCCGGTTCCTCTTCTAC
TGGGTCGGGCCCGACGTCTCGTTGATCTCGACTTCTATTCCATCATCAAGGACCTCGCTCCTGATGGGGA
GGCACAAGTTTTGAATATCCGAGGGTCACGTCCCGAGGACGATGACGAGCACGGTTCAATCGACTAA