SecReT6
Protein ID: 375132906
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00781
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]812010..813227 [-]
Producthypothetical protein
NoteTssL
UniProt IDF0LYJ5
KEGG IDvfu:vfu_B00781
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.00E-46, Aligned region: 54..261
SPOR [PF05036], Evalue: 2.40E-10, Aligned region: 222..235
SPOR [PF05036], Evalue: 2.40E-10, Aligned region: 332..399
Protein Sequence: 405 a.a.     [Download]
>gi|375132906|ref|YP_005049314.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MNQLFDEDTVTIAANEPTPASSQPEKSVRLSNANMLKNHARYSMAQQQGQLFDNSILRVSSDLLSLIISV
KRMQCPADLYTFRAGIKHAITELKYRIAALDYPPSVADKTCFLFAVMIDEQILHSSWGDEAGWENQTLVS
ELFNIKNGGEQFYIIAERALLQPVLLVDLLELIYIMLKMGFRGRYRTKGKDQLTALMKRLEEAVFAKPVA
YSAAERLAPVAADDMAARHAKRPKKPVGVWRSVALFVVMSALVWGGLRYWYEATSPQKALPFTQLTQFTQ
TYYSKGSVQDQEYVYESTSSDMASEGWHPTPQTIADREPAPPAVAKQPAGNRQWLVQLASFNNPSDAAKF
IARYKPRVPSAQVKTVNGRYRVVSESYTTKSAAIDTLSTAKSAGISDAFLLIDTN
 
Nucleotide Sequence: 1218 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c813227-812010 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGAATCAATTGTTCGATGAAGATACCGTCACGATCGCCGCCAATGAGCCGACGCCTGCGTCCAGTCAGC
CGGAAAAATCCGTTCGTCTGAGCAACGCCAATATGCTCAAAAACCATGCGCGTTACAGCATGGCTCAGCA
GCAGGGGCAACTGTTTGACAACAGCATTCTGCGCGTCAGTTCGGACTTGCTGTCGCTGATCATTTCGGTC
AAACGTATGCAATGTCCGGCCGATCTTTACACGTTCCGCGCGGGCATCAAGCACGCGATCACCGAGCTTA
AATATCGCATTGCCGCGTTGGATTATCCGCCTTCGGTGGCGGACAAAACCTGTTTTCTGTTTGCCGTGAT
GATCGACGAACAGATCCTGCACTCATCATGGGGCGATGAAGCGGGTTGGGAAAATCAAACGCTGGTCAGC
GAACTGTTCAATATCAAAAACGGCGGTGAGCAGTTTTACATCATTGCCGAGCGTGCGCTGCTGCAACCGG
TGTTGTTGGTCGATCTGCTCGAGTTAATCTACATCATGCTCAAGATGGGCTTTCGTGGTCGCTATCGCAC
CAAAGGTAAGGATCAACTGACCGCGCTGATGAAACGTCTGGAAGAGGCGGTGTTTGCCAAACCGGTGGCG
TATTCGGCCGCTGAACGTCTGGCGCCCGTGGCCGCCGACGATATGGCCGCTCGTCATGCCAAACGGCCGA
AAAAACCGGTCGGCGTGTGGCGTTCGGTGGCGCTGTTTGTGGTGATGTCGGCTTTGGTGTGGGGCGGATT
ACGCTATTGGTATGAGGCGACCTCGCCGCAAAAAGCACTGCCTTTCACCCAACTGACGCAGTTTACCCAA
ACCTATTACAGCAAGGGCAGCGTGCAGGACCAAGAGTACGTGTATGAAAGTACCTCGTCGGACATGGCAT
CGGAAGGGTGGCATCCCACGCCGCAAACCATCGCCGATCGAGAACCGGCGCCCCCCGCAGTGGCAAAACA
ACCCGCAGGCAACCGTCAGTGGTTGGTGCAACTGGCGAGTTTTAATAATCCGAGTGATGCGGCCAAGTTC
ATTGCCCGCTACAAACCTCGCGTACCGAGTGCTCAGGTCAAAACGGTGAACGGGCGTTATCGCGTGGTGA
GCGAAAGCTATACGACCAAATCGGCTGCGATTGATACGCTCTCTACCGCCAAAAGTGCCGGGATTTCCGA
TGCCTTTTTACTCATTGATACCAATTAG