SecReT6
Protein ID: 375132907
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00782
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]813232..814521 [-]
Producthypothetical protein
NoteTssK
UniProt IDF0LYJ6
KEGG IDvfu:vfu_B00782
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.20E-104, Aligned region: 7..428
Protein Sequence: 429 a.a.     [Download]
>gi|375132907|ref|YP_005049315.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MFIAPQHFQQQDRHTHQYIQKYVALSSQGSGFGVSALELDHHYLKIGKFGVVHCQGIFPEGTLFDCVKEL
LLDIPEGTLNQRVYLALPLSVEGENEYGSRADKRRYVVSQVNLFDASDVVQSAIEAELAEPNIRLVLEGE
DVTGLALLPVAKVLERQENGEVILDRSFIPACLHYGASQLLKERLKEIFILTQARANSVVQRIGAGQQTK
SDLSLMREFLWLQTLNRWLPWLHLTLEQPQTSVDALYEGLVSFSAELDSFKPAMTAMPEPLVRDDLKQGF
AGVFAQLREKLSMVQSDNVTEFSWDTNLFERRRLLRLSIPNLNQIEGRRFVMAVHASIGTAALLQVFPSA
CTLSGLSQIADLVRNSQSGVPIQVLPVAPNELKAQADVAYFEIDTAHEYWQQLKTKREPIALHVDSRVPD
LSIKLYALG
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c814521-813232 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTTTATCGCCCCGCAGCATTTTCAGCAGCAGGACCGCCATACGCATCAGTACATTCAGAAATATGTCG
CCCTGTCTTCACAGGGCAGTGGTTTTGGTGTGTCGGCGCTGGAGCTTGATCATCATTACCTCAAAATCGG
TAAGTTTGGCGTGGTGCATTGCCAAGGGATTTTCCCAGAAGGGACGCTGTTTGATTGTGTCAAAGAGCTG
CTGCTGGATATTCCGGAAGGTACCCTCAACCAACGCGTCTATCTGGCGTTGCCATTGTCGGTGGAAGGCG
AAAATGAGTACGGCAGCCGTGCAGACAAGCGTCGTTACGTGGTGTCACAGGTCAATCTGTTTGATGCCAG
TGATGTGGTGCAGAGCGCAATTGAAGCTGAGCTCGCCGAGCCGAATATCCGTCTGGTACTTGAAGGGGAA
GACGTGACGGGGCTGGCGTTGCTGCCAGTGGCGAAAGTGTTGGAACGGCAGGAAAACGGAGAGGTCATCC
TTGATCGCAGCTTTATTCCGGCGTGTCTCCACTACGGCGCTTCGCAACTACTCAAAGAGCGTTTGAAAGA
GATTTTCATCCTGACGCAAGCCCGCGCCAACAGCGTCGTGCAACGCATTGGCGCGGGGCAGCAAACCAAA
AGTGATCTGAGCTTGATGCGCGAATTTCTGTGGTTACAGACGTTAAACCGCTGGCTGCCATGGCTGCATC
TGACGCTTGAACAGCCACAGACCAGCGTGGACGCGTTGTATGAAGGGCTAGTGAGCTTTTCCGCTGAACT
CGACAGCTTTAAACCAGCGATGACAGCCATGCCGGAACCGCTGGTGCGTGATGACCTCAAGCAGGGCTTT
GCGGGCGTGTTCGCCCAACTGCGCGAGAAACTGTCGATGGTTCAGAGCGACAACGTGACGGAATTCAGCT
GGGATACCAACCTGTTCGAGCGTCGCCGCTTGCTGCGTTTGTCGATTCCGAACCTCAATCAGATTGAAGG
CCGCCGCTTTGTGATGGCGGTGCATGCATCGATTGGGACCGCGGCGTTGCTGCAGGTGTTCCCGAGTGCG
TGCACGCTGAGTGGGTTGAGCCAGATTGCCGACTTGGTGCGCAACAGTCAGTCCGGTGTGCCGATTCAGG
TGCTGCCGGTTGCGCCGAATGAACTGAAAGCGCAGGCGGATGTGGCCTATTTCGAAATCGATACCGCCCA
TGAGTACTGGCAACAACTGAAAACCAAACGAGAGCCGATCGCGCTGCACGTCGACAGCCGTGTGCCGGAT
CTCTCCATTAAGCTCTACGCCCTGGGTTGA