SecReT6
Protein ID: 375132908
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00783
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]814568..815083 [-]
Productlipoprotein
NoteTssJ
UniProt IDF0LYJ7
KEGG IDvfu:vfu_B00783
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.20E-33, Aligned region: 16..157
Protein Sequence: 171 a.a.     [Download]
>gi|375132908|ref|YP_005049316.1| lipoprotein [Vibrio furnissii NCTC 11218]
MSWLNRIRLAAIGCCALVLSACSSSSSTTTFAPTLKVPLVVEASKDINVFDDEQARPVVVRVYQLQDAGN
FQKADFISLYNADQSVLADSLVDLQTLAPVLPGELRNLTLDVQQQSRFIAVLVEFAHYETATAKAYLALV
SEPEEYPVYIHITKQKVELTQPVSKSWWNVF
 
Nucleotide Sequence: 516 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c815083-814568 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGAGCTGGCTGAATAGGATTCGTCTGGCCGCAATCGGCTGCTGCGCGTTGGTGCTGAGTGCTTGTAGCT
CAAGCAGTTCAACCACCACGTTTGCCCCCACACTCAAAGTGCCGCTGGTGGTTGAAGCGAGTAAAGACAT
CAATGTGTTTGATGATGAACAAGCGCGACCGGTGGTCGTGCGCGTGTATCAGCTGCAGGATGCCGGCAAT
TTCCAGAAAGCCGATTTCATCAGCCTGTACAACGCGGATCAGAGCGTGCTGGCCGATTCGCTGGTGGATT
TGCAGACACTCGCGCCAGTCCTGCCGGGAGAGCTGCGCAACCTGACCTTGGATGTCCAGCAACAAAGCCG
ATTTATCGCCGTATTGGTCGAATTTGCCCATTACGAAACCGCGACCGCCAAAGCGTATCTGGCGCTGGTG
AGCGAACCCGAAGAGTACCCAGTTTATATCCACATCACCAAGCAGAAGGTTGAGCTGACTCAACCGGTCA
GCAAGTCGTGGTGGAACGTGTTTTAA