SecReT6
Protein ID: 375132909
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00784
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]815080..816069 [-]
Producthypothetical protein
NoteFha
UniProt IDF0LYJ8
KEGG IDvfu:vfu_B00784
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-18, Aligned region: 29..96
Protein Sequence: 329 a.a.     [Download]
>gi|375132909|ref|YP_005049317.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MTISFQIIDLPEDEQIGSRQVSLPVSGGTLGRSFECTIQLPDFQRTLSRVHADIQPHPKGGYQIIDRSTN
GVFVNDVLVGKGESQRLSDGDRIVIGAYTLLVSDMDALLTRAPQQSDDTETASLKGAADSPFAASMVLDD
SQDTAFGFAHLDEIQDAVQGETPFSTENVLGDDLYGYDPFEDDERWVLEQSQSEDTTEQIVLMPEATQFN
DNNHAPQHSVTVSDHRQIESLENSIEQLSSMLKQQQLSVAGGIDRERLMTCIESTLEKFLDNFNPSHLEE
EFNDYLSGWGNKDKKYWALYKKQFQRKTERREFSRQFSSLLFEALREKR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c816069-815080 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGACGATCAGTTTTCAGATAATCGACCTTCCTGAAGATGAACAAATCGGTAGCCGTCAGGTATCACTGC
CGGTCAGTGGCGGCACGTTAGGACGCTCGTTTGAGTGCACCATTCAGTTGCCGGATTTTCAGCGCACACT
GTCACGTGTCCACGCTGACATTCAACCGCATCCGAAAGGCGGCTACCAAATTATCGATCGCAGTACCAAC
GGCGTATTTGTCAATGATGTGCTGGTGGGCAAAGGCGAATCGCAGCGCCTCAGCGATGGCGACCGGATTG
TGATTGGGGCTTACACCTTATTGGTCAGCGATATGGATGCGTTGTTGACGCGCGCGCCACAACAGAGCGA
CGACACCGAAACGGCCAGCCTGAAGGGCGCCGCCGATTCACCGTTTGCGGCCAGCATGGTCTTAGATGAC
AGTCAGGACACCGCATTTGGTTTTGCGCATCTGGACGAGATTCAAGATGCGGTGCAAGGCGAGACGCCGT
TTTCGACGGAGAACGTGCTGGGCGATGACCTGTATGGTTACGACCCGTTTGAAGACGATGAGCGTTGGGT
GCTGGAGCAGAGCCAGAGTGAAGATACCACCGAACAGATTGTGTTGATGCCCGAAGCGACTCAGTTCAAT
GACAACAATCATGCCCCGCAGCACAGTGTGACGGTCAGCGATCATCGTCAGATAGAGTCACTGGAAAACA
GCATTGAACAGCTGAGTTCGATGCTCAAACAGCAACAGCTGAGCGTGGCGGGTGGCATTGACCGTGAACG
TCTGATGACCTGCATTGAGTCGACACTGGAAAAATTCCTCGACAATTTCAACCCGAGTCATCTGGAAGAG
GAGTTCAACGACTATCTTTCTGGCTGGGGGAACAAAGATAAAAAATATTGGGCGCTGTATAAGAAACAGT
TCCAGCGCAAAACCGAGCGTCGGGAGTTTTCCCGTCAGTTCTCCTCCCTGTTATTTGAAGCCCTGAGAGA
GAAACGATGA