SecReT6
Protein ID: 375132911
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00786
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]816809..818377 [-]
ProductATP-dependent Clp protease ATP-binding subunit
NoteTssH
UniProt IDF0LYK0
KEGG IDvfu:vfu_B00786
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.00E-42, Aligned region: 251..418
ClpB_D2-small [PF10431], Evalue: 3.00E-12, Aligned region: 424..497
AAA_5 [PF07728], Evalue: 5.10E-09, Aligned region: 256..377
AAA [PF00004], Evalue: 2.20E-07, Aligned region: 81..118
AAA [PF00004], Evalue: 2.20E-07, Aligned region: 257..377
Zeta_toxin [PF06414], Evalue: 3.60E-05, Aligned region: 248..296
AAA_22 [PF13401], Evalue: 0.00047, Aligned region: 9..31
AAA_22 [PF13401], Evalue: 0.00047, Aligned region: 255..337
Sigma54_activat [PF00158], Evalue: 0.0008, Aligned region: 255..374
AAA_17 [PF13207], Evalue: 0.0008, Aligned region: 79..124
AAA_17 [PF13207], Evalue: 0.0008, Aligned region: 256..293
AAA_17 [PF13207], Evalue: 0.0008, Aligned region: 441..446
AAA_16 [PF13191], Evalue: 0.0011, Aligned region: 17..117
AAA_16 [PF13191], Evalue: 0.0011, Aligned region: 247..276
AAA_16 [PF13191], Evalue: 0.0011, Aligned region: 322..350
AAA_16 [PF13191], Evalue: 0.0011, Aligned region: 407..489
AAA_33 [PF13671], Evalue: 0.0062, Aligned region: 23..65
AAA_33 [PF13671], Evalue: 0.0062, Aligned region: 255..276
AAA_33 [PF13671], Evalue: 0.0062, Aligned region: 426..460
Protein Sequence: 522 a.a.     [Download]
>gi|375132911|ref|YP_005049319.1| ATP-dependent Clp protease ATP-binding subunit, partial [Vibrio furnissii NCTC 11218]
MVKVEEPSADDALQMLRGVAQSLRRHHGVFIREDALDAAVQLSIRYLPSRQLPDKAISLLDTACARIALT
QGAKPEQIESLEQQLRYLNSELEALENEDTVLVGSAVDRQSIKDTVARKQAELLTLTERWEQEKALVADI
KQLTGEIETRFHAGEAADPQTQHLLQGKLDELVQLQDEEPMVFPMVDAQVIAEVISGWTGIPSGNMVKEE
VASLLSLEDSLHRRVIGQKTAINELAKSIRISRAGLTDSRKPVGVFLMCGPSGVGKTETAMALADEVFGG
ENNMTVINMTEFKEEHKISMLLGSPAGYVGFGEGGVLTEAIRRNPYTVLLLDEMEKAHPGVHDLFYQIFD
KGHIKDSEGRTVDFKNTIIIMTSNAADQAICDVCDDNEQRPENDDLLEQIRPALLRHFKPAFLGRTTIVP
YYPLNQDELSQITAISLNRIAKKLHEQYKAEFIWDQAFVDFVVGRNTDPTTGGRAVEQIINRSLMPRLAE
ECIQRLSEGLPIQKVSVSADLNQGGALLLDIV
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c818377-816809 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
GTGGTGAAAGTGGAAGAGCCAAGTGCCGACGATGCGCTGCAAATGCTGCGCGGCGTGGCACAGTCGCTAC
GTCGTCACCACGGGGTGTTCATTCGTGAGGACGCGCTGGATGCGGCGGTACAACTCTCGATTCGTTATCT
GCCCTCTCGTCAGTTACCCGACAAAGCCATCAGTCTGCTGGATACGGCCTGTGCGCGCATTGCGCTGACG
CAGGGTGCAAAACCTGAACAGATCGAATCGCTTGAGCAGCAACTGCGCTACCTCAACAGCGAACTTGAAG
CGCTGGAGAATGAAGATACCGTGCTGGTGGGCAGCGCGGTTGATCGTCAGTCGATCAAAGACACCGTGGC
GCGCAAGCAAGCAGAACTACTCACGCTGACGGAACGTTGGGAGCAGGAAAAAGCGCTGGTAGCAGACATC
AAACAGCTGACCGGCGAGATTGAGACCCGCTTCCATGCTGGCGAAGCAGCGGACCCACAAACCCAGCACC
TATTGCAAGGCAAGCTGGACGAGCTGGTTCAACTGCAAGATGAAGAGCCCATGGTGTTCCCAATGGTCGA
TGCACAGGTGATTGCGGAAGTGATCTCCGGCTGGACGGGCATTCCAAGCGGCAACATGGTCAAAGAAGAA
GTGGCGTCACTGCTGTCGCTGGAAGACTCGCTCCACCGCCGCGTGATTGGCCAAAAAACCGCGATCAACG
AGCTGGCGAAAAGTATCCGTATTTCACGAGCTGGCTTAACCGACAGCCGTAAACCTGTCGGCGTGTTTCT
GATGTGTGGCCCGAGTGGTGTCGGTAAAACCGAAACGGCGATGGCGCTGGCAGATGAAGTCTTCGGCGGT
GAAAACAACATGACCGTGATTAACATGACGGAGTTTAAAGAAGAGCACAAAATTTCCATGCTGCTGGGTT
CACCGGCCGGTTATGTCGGTTTTGGTGAAGGCGGCGTGCTGACCGAAGCGATTCGCCGCAACCCGTACAC
CGTGCTGCTGCTGGACGAGATGGAAAAAGCGCATCCGGGTGTGCATGACCTGTTCTACCAAATCTTTGAT
AAAGGCCATATTAAAGACAGCGAAGGCCGCACGGTCGATTTCAAAAATACCATCATCATCATGACCTCCA
ACGCGGCCGATCAGGCGATTTGCGATGTGTGTGATGACAACGAACAACGTCCGGAAAATGACGATCTGCT
GGAGCAAATTCGCCCAGCGCTGCTGCGTCACTTTAAGCCTGCGTTCCTCGGCCGTACCACGATTGTCCCT
TATTACCCGCTCAATCAGGACGAGTTGAGTCAGATCACCGCGATCAGCCTGAACCGCATTGCGAAAAAAC
TGCACGAGCAGTACAAGGCCGAGTTTATCTGGGATCAGGCCTTCGTTGATTTTGTCGTGGGACGCAACAC
GGACCCAACCACGGGTGGTCGCGCGGTGGAGCAAATCATCAACCGCTCTCTGATGCCACGTTTGGCGGAA
GAGTGCATTCAGCGCCTGAGTGAAGGGCTGCCTATTCAGAAAGTTTCGGTCAGTGCGGATCTCAATCAAG
GCGGTGCCCTGCTGCTGGATATCGTATGA