SecReT6
Protein ID: 375132912
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00787
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]818432..819343 [-]
ProductATP-dependent Clp protease ATP-binding subunit
NoteTssH
UniProt IDF0LYK1
KEGG IDvfu:vfu_B00787
PDB IDNA
Domain hit(s) vs Pfam AAA [PF00004], Evalue: 5.50E-11, Aligned region: 31..53
AAA [PF00004], Evalue: 5.50E-11, Aligned region: 191..287
AAA_16 [PF13191], Evalue: 4.00E-06, Aligned region: 26..75
AAA_16 [PF13191], Evalue: 4.00E-06, Aligned region: 169..207
AAA_16 [PF13191], Evalue: 4.00E-06, Aligned region: 235..270
AAA_22 [PF13401], Evalue: 0.00031, Aligned region: 191..276
AAA_25 [PF13481], Evalue: 0.0032, Aligned region: 191..215
AAA_25 [PF13481], Evalue: 0.0032, Aligned region: 247..286
Protein Sequence: 303 a.a.     [Download]
>gi|375132912|ref|YP_005049320.1| ATP-dependent Clp protease ATP-binding subunit, partial [Vibrio furnissii NCTC 11218]
MTQTVAAIEIEHWLVQLLLSKETHLMAFINQQHIDANRLMAELTARIERLTKGSASQPAISSALSSLLEE
AWLQASVNFSQGQVSSLHLLLVLTQTDSFGVKKLALESLNNVSQEALSAQITQLQTVQAGSSSAPAASGH
SGPVAGGALDKYTVNLTQQAREGKIDPISGRNSEVRLAIDILCRKRQNNPILVGEPGVGKTAVVEGLALR
VVSGEVPPAIQGVEIHTLDLGLLQAGASIKGEFENRLKDVINEVKNSPTPIIVFIDEAHTLIGAGGAAGQ
NDAANLLKPALARGEFRSMAATT
 
Nucleotide Sequence: 912 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c819343-818432 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGACACAAACGGTGGCCGCCATTGAAATTGAACACTGGTTGGTGCAACTGCTGTTGTCCAAAGAAACGC
ATTTGATGGCGTTCATCAATCAACAGCACATCGATGCGAACCGCCTGATGGCCGAGCTGACTGCGCGTAT
TGAACGCCTGACGAAAGGCTCTGCCAGCCAACCTGCGATCAGCAGTGCATTGAGCTCGCTGCTGGAAGAG
GCTTGGTTGCAGGCGTCGGTCAATTTCTCTCAGGGGCAGGTTAGCAGCCTGCATCTGCTGTTAGTCCTGA
CTCAAACCGACAGTTTTGGTGTGAAGAAACTGGCGCTGGAGAGTTTGAACAATGTGTCTCAGGAAGCGTT
GTCTGCTCAGATTACGCAGTTGCAAACCGTTCAGGCGGGTTCTTCTTCTGCGCCTGCTGCCAGTGGCCAC
AGTGGTCCGGTCGCCGGTGGCGCGCTGGATAAATACACCGTCAACCTGACGCAACAGGCGCGTGAGGGCA
AAATTGATCCGATTTCGGGTCGTAACAGCGAAGTGCGTCTGGCGATTGATATCTTGTGTCGTAAACGTCA
GAACAACCCGATTTTGGTCGGTGAACCGGGGGTGGGTAAAACCGCGGTGGTTGAAGGTCTGGCGCTGCGC
GTCGTCAGTGGTGAAGTCCCGCCAGCGATTCAGGGCGTGGAAATTCATACGCTGGATTTGGGTCTGTTGC
AGGCGGGTGCGAGCATTAAAGGCGAGTTTGAAAACCGCCTGAAAGATGTCATTAACGAAGTGAAAAACTC
ACCGACGCCCATCATTGTCTTTATCGATGAAGCACACACGCTGATTGGGGCGGGTGGAGCTGCGGGTCAG
AACGATGCGGCGAACCTGCTGAAACCTGCGCTGGCTCGCGGCGAGTTCCGTTCCATGGCCGCGACAACCT
GA