SecReT6
Protein ID: 375132913
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00788
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]819393..820418 [-]
Producthypothetical protein
NoteTssG
UniProt IDF0LYK2
KEGG IDvfu:vfu_B00788
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.60E-43, Aligned region: 15..312
Protein Sequence: 341 a.a.     [Download]
>gi|375132913|ref|YP_005049321.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MSLSARQTVKQHLLTHPHEFDFVQVIRLLQAISQQESLSVRLQSDPMPHGAPTEVTRIEKEHDEVRVQLG
LEALSGCKGVIPDYLYAEMLHSLHQDDRALQRFLDVFNQRYYELKAYVESAANLMLREEREAASRYALSR
LTQKQALACMFSLPMQRGQKVDQSVLRYGLALASRNRNLAQLKRLLCDYFDLDITPKVVPSAVYRIRNQD
QTRIGGHRGQNHRLGRGMVMGRQGNQAYQTLEIWITPRNRNEFIGLERNRHFARSLKSLVQSYLRESLET
RLYLYVKREYINAPVISAVAGGVRLGEASCLSPQRRAADYRKILLQSENVYVTGKTGQPGQ
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c820418-819393 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTCTCTGAGCGCGCGCCAGACGGTCAAACAGCATTTGCTGACTCACCCGCATGAATTTGATTTTGTGC
AGGTGATTCGTCTGTTGCAGGCGATCAGCCAACAAGAATCGCTGTCGGTGCGTTTGCAATCGGATCCGAT
GCCGCATGGCGCGCCGACTGAAGTCACGCGTATCGAAAAAGAGCATGACGAAGTACGTGTTCAGCTTGGC
TTGGAAGCATTGTCCGGTTGCAAAGGGGTCATTCCCGATTATCTGTATGCAGAAATGCTGCATAGTCTGC
ATCAGGATGATCGCGCGCTACAGCGCTTTCTGGATGTGTTTAACCAGCGTTATTACGAACTCAAAGCCTA
TGTGGAAAGCGCTGCGAACCTGATGCTGCGCGAGGAGCGCGAAGCGGCGTCTCGTTATGCGCTGTCACGC
CTGACTCAGAAGCAGGCGTTGGCCTGTATGTTCTCGCTGCCCATGCAGCGCGGGCAGAAAGTCGATCAGA
GTGTGCTGCGTTATGGTCTGGCTCTCGCGTCCCGCAACCGCAACCTGGCGCAACTCAAGCGTCTTCTGTG
TGACTATTTCGACCTCGATATCACCCCCAAAGTGGTGCCTTCGGCGGTTTATCGCATTCGCAATCAGGAC
CAAACCCGTATCGGCGGTCACCGTGGTCAGAACCACCGTCTTGGCCGTGGCATGGTCATGGGCCGTCAGG
GCAATCAGGCCTACCAGACGCTGGAAATCTGGATCACGCCGCGCAACCGCAATGAATTTATTGGCTTAGA
ACGCAATCGTCACTTTGCCCGTTCACTGAAATCTCTGGTGCAGTCCTACTTGCGTGAAAGTCTGGAAACG
CGCCTGTACCTGTATGTGAAACGTGAATACATCAACGCCCCGGTGATATCGGCCGTGGCTGGCGGCGTTC
GCCTAGGCGAAGCCAGCTGTCTTTCCCCGCAGCGTCGCGCTGCGGATTATCGGAAAATATTATTACAATC
GGAGAACGTCTATGTCACAGGTAAAACTGGGCAACCTGGTCAGTAA