SecReT6
Protein ID: 375132914
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00789
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]820409..822184 [-]
Producthypothetical protein
NoteTssF
UniProt IDF0LYK3
KEGG IDvfu:vfu_B00789
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-125, Aligned region: 5..590
Protein Sequence: 591 a.a.     [Download]
>gi|375132914|ref|YP_005049322.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MSDQLLSYFERELTYIRRALDGFGKDFPEHASSMRLNQSSQEDPNISRLIDAVALLTAKTEKRMDEQFPE
ILQDLFHVLYPGYLQIVPSYAPLSLNLEDNAVTEAVVLPQGSEVAVAVNDAECRFTLAQALTIEPYVIAA
LRAESAPFNFPTPAGLRRAEAVIQVELACSDPSVLFSQLSLQHFDFYVRGFENSARGLVDMLLLNTEVLS
VFDASGQQRVVDATRLKSRVADPDFHWLPQYGNHLGGFDLLRDYFAYPDKAAYLRITDLGQELMSFDANR
VTLNFFVRQLPAEYLRLFSRDVLALNTAPAINLYAQYGDPIRYDFTRLSMPVVADTRAKNELTVVSVDEV
NEVLPTGEVPLSPNYEGGYWLDDESPRWQIHQFWDERGRRQMDISVSYTELQPAQESVVLSLRLHVCNGR
LPCLIPANAVMESLAAIDLPGDLKLLKTPTAPQYPPLDNQLSWRFVAMLNANFSGLIQNEDPTRMLQDVL
RLCSNSAQCAVADAIKKVAYNHVVAPLTINGRSIFASGTEVMILIDDELLDSNFAVVSEVLNAYFRQYCS
FDRFVQVSVERFGSDEAGIHFDKTHGSQLCL
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c822184-820409 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
TTGTCTGATCAATTATTGAGTTATTTTGAGCGCGAGCTCACCTACATTCGTCGTGCGCTGGATGGGTTTG
GCAAAGACTTTCCCGAACACGCTTCGTCAATGCGTTTGAATCAGAGCAGTCAGGAAGACCCGAATATCAG
TCGCCTGATTGATGCGGTGGCGCTGCTGACCGCGAAAACTGAAAAACGCATGGATGAGCAGTTCCCCGAG
ATCCTGCAGGATCTGTTTCACGTCCTGTATCCCGGCTATCTGCAAATTGTGCCGAGTTATGCGCCGCTGT
CGCTCAACCTTGAAGACAACGCAGTGACCGAAGCGGTGGTGTTGCCGCAAGGCTCAGAAGTGGCGGTGGC
AGTGAATGACGCCGAGTGCCGCTTTACGCTGGCGCAGGCATTGACGATTGAACCGTATGTGATTGCGGCG
TTGCGCGCCGAGTCGGCGCCGTTTAATTTCCCGACGCCAGCCGGACTGCGCCGCGCAGAAGCGGTGATTC
AGGTTGAACTGGCGTGCAGCGATCCTTCCGTGTTGTTTTCGCAGTTATCGCTACAACATTTTGATTTCTA
TGTGCGCGGGTTTGAAAACAGCGCCCGTGGTCTGGTTGACATGCTGCTGCTCAATACCGAAGTGTTGTCG
GTATTTGATGCGTCGGGTCAGCAGCGTGTCGTCGATGCGACGCGGTTGAAATCGCGCGTGGCCGATCCCG
ATTTTCACTGGCTGCCGCAATATGGCAACCACTTGGGTGGCTTTGACCTGCTGCGCGACTACTTTGCTTA
CCCGGACAAAGCGGCCTACTTGCGGATTACTGACCTTGGCCAGGAACTGATGAGTTTTGACGCCAATCGC
GTCACGCTCAACTTCTTTGTGCGTCAACTGCCGGCGGAATATCTGCGCCTGTTCAGTCGTGACGTGTTGG
CGCTCAATACCGCGCCCGCGATCAATCTCTACGCTCAGTATGGCGATCCGATTCGTTATGATTTCACGCG
CCTGTCGATGCCGGTTGTCGCGGACACGCGTGCTAAAAACGAACTGACGGTGGTCAGTGTGGACGAAGTC
AACGAAGTGCTGCCGACGGGCGAAGTGCCGCTGAGTCCGAACTACGAAGGCGGATACTGGCTCGATGATG
AGTCACCGCGCTGGCAGATTCATCAGTTCTGGGACGAGCGTGGCCGTCGTCAGATGGACATTTCTGTCAG
TTATACCGAGCTGCAACCGGCTCAGGAGTCGGTGGTGCTGTCGCTGCGTCTGCACGTGTGTAACGGCCGT
TTACCGTGCCTCATTCCGGCGAATGCGGTGATGGAATCGCTGGCTGCGATTGATCTACCGGGCGATCTGA
AACTACTGAAAACACCGACCGCGCCGCAGTATCCGCCACTGGACAATCAGCTGAGCTGGCGTTTTGTGGC
CATGCTCAACGCGAACTTTTCCGGGCTGATTCAGAACGAAGACCCGACCCGAATGCTGCAGGACGTGCTG
CGTTTGTGCAGTAACAGTGCGCAGTGCGCCGTCGCGGATGCGATTAAAAAAGTGGCCTACAACCACGTGG
TCGCGCCACTGACGATCAATGGCCGCAGCATTTTTGCGTCCGGCACTGAGGTGATGATTCTGATCGATGA
TGAACTGCTCGACAGCAACTTTGCCGTCGTCAGCGAAGTGCTGAATGCCTATTTCCGCCAATATTGCAGT
TTTGACCGTTTCGTTCAGGTCAGTGTGGAGCGGTTTGGTAGCGATGAGGCCGGGATTCATTTTGATAAAA
CGCACGGGAGCCAGCTATGTCTCTGA