SecReT6
Protein ID: 375132915
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00790
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]822177..822599 [-]
ProductGPW / gp25 family
NoteTssE
UniProt IDF0LYK4
KEGG IDvfu:vfu_B00790
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.60E-14, Aligned region: 15..115
Protein Sequence: 140 a.a.     [Download]
>gi|375132915|ref|YP_005049323.1| GPW / gp25 family [Vibrio furnissii NCTC 11218]
MSFWRTFLDKSGSSNHELLDSVRYQLTALLNSEAPMMALPKGFSAVEASNFCFGLDCAHSISSQINKDQF
ARSMEKWVRTFEPRLSEVSVFVEESQPGKNVMRFSLMAKVKTANGEHVFLFDSNISLSSQTARMEGQEVV
 
Nucleotide Sequence: 423 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c822599-822177 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGAGTTTCTGGCGCACATTCCTCGATAAAAGTGGCAGCAGCAATCATGAGCTGCTTGATTCGGTACGCT
ACCAGCTGACGGCGCTGCTCAATTCTGAAGCGCCGATGATGGCACTGCCAAAAGGCTTTTCGGCCGTCGA
AGCCTCCAACTTTTGCTTCGGTCTGGACTGCGCACACAGCATCAGCAGCCAGATCAACAAAGATCAGTTT
GCCCGTTCGATGGAAAAGTGGGTCAGAACCTTTGAGCCGCGCCTGTCAGAAGTGAGCGTCTTTGTCGAAG
AGAGCCAGCCGGGCAAAAACGTGATGCGTTTTTCGCTGATGGCCAAGGTGAAAACCGCCAACGGCGAGCA
CGTGTTCCTGTTTGATTCCAATATCAGTCTGTCCAGCCAGACCGCCCGTATGGAGGGACAAGAAGTTGTC
TGA