SecReT6
Protein ID: 375132916
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00791
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]822596..824020 [-]
Producthypothetical protein
NoteTssC
UniProt IDF0LYK5
KEGG IDvfu:vfu_B00791
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.00E-118, Aligned region: 48..461
Protein Sequence: 474 a.a.     [Download]
>gi|375132916|ref|YP_005049324.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MFDADFQHAFCQLNPEAEDFLPQALAQLLKLDPQMLSNREVLLASLLRLIAEIDDRMSRQLSTIIHHPDF
SRLEASWKGVEALVSLPVNYQKVQIKIRNMSWEDLSQELNTAVSLRRTSLYNLIGNRELNTSGGQPFGLV
VVDHALSMSLDGDYDDLYTLELLSQLGDLCLCPFILSPSDDFFGESGADWFSDIERVKKILHGPEFVAWQ
RVRRLSSARFIGLVVPKIRLREAYGRSASSAIQFREYSANPAGLWGSAAYLFASVAIREFNRINWFGFMK
SRWQDKYYGSLGNVPPGGAGVSATLRPTPDIRLITEMGTFYADEGFIPLCHSLTTDKYFFRGNNSIWSEA
KDDTESVMGQIQTTLMICRIAHYLKVQIRSMIGNFQTAEECETYLNRWLDKYSSNLFNADEATLAKYPLS
KGRVEVREIAGQHGRYTCDVFVQPQYQFDNVCGEVLLSTDLGPESEPRFAGGLV
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c824020-822596 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTTTGATGCTGATTTTCAACACGCGTTTTGCCAGCTCAACCCTGAGGCGGAAGATTTTCTGCCTCAGG
CGTTGGCGCAACTGTTGAAACTCGACCCACAGATGTTGAGTAATCGTGAGGTGCTGTTGGCATCACTGCT
GCGTTTGATTGCAGAGATTGACGACCGCATGTCGCGTCAGCTATCAACCATCATTCATCATCCTGATTTT
TCTCGTCTCGAAGCATCCTGGAAAGGGGTCGAGGCCTTAGTGTCTCTGCCGGTGAATTACCAGAAAGTGC
AGATTAAAATCAGAAATATGTCCTGGGAGGATCTCTCCCAGGAACTTAACACCGCTGTCTCATTGCGACG
CACGTCCCTCTATAACCTGATTGGTAACCGCGAGCTCAATACCTCCGGTGGTCAGCCGTTTGGTCTGGTG
GTGGTGGATCATGCGTTGTCGATGAGTCTTGATGGTGACTACGATGACCTCTACACATTAGAGCTGTTGT
CTCAACTGGGTGATCTTTGTCTTTGTCCGTTTATTCTCTCTCCGTCGGATGACTTTTTTGGCGAATCAGG
TGCCGACTGGTTTTCAGACATTGAACGGGTAAAGAAAATATTACACGGTCCGGAATTTGTGGCCTGGCAA
CGGGTGAGACGTTTGTCTTCCGCCCGTTTTATTGGTTTGGTGGTGCCGAAGATTCGCCTGCGCGAAGCGT
ATGGCCGCAGCGCCAGCAGCGCCATTCAATTTCGGGAATACAGCGCGAATCCGGCCGGTTTGTGGGGCAG
CGCGGCGTATCTGTTTGCCTCGGTTGCGATTCGTGAATTCAATCGCATCAACTGGTTTGGCTTTATGAAG
TCACGCTGGCAGGACAAATATTACGGCTCGCTCGGCAATGTGCCACCGGGCGGCGCAGGCGTCAGTGCCA
CACTCAGACCCACACCCGATATCCGTTTGATCACCGAGATGGGCACGTTTTACGCCGACGAAGGCTTCAT
TCCGCTCTGTCACAGCCTGACCACGGACAAATATTTCTTTCGCGGCAACAACTCCATCTGGAGTGAAGCG
AAAGACGATACCGAATCGGTGATGGGCCAGATCCAAACCACGCTCATGATCTGTCGCATTGCGCATTATC
TCAAAGTGCAGATCCGCAGCATGATCGGGAATTTCCAAACCGCAGAAGAGTGTGAAACCTACCTCAACCG
TTGGTTGGATAAGTATTCCAGCAACCTGTTTAACGCCGATGAAGCCACGCTGGCCAAGTATCCGCTCAGT
AAAGGCCGGGTTGAGGTGCGTGAAATCGCTGGTCAACATGGCCGCTATACCTGTGACGTATTTGTTCAGC
CTCAGTACCAGTTCGACAACGTGTGCGGCGAAGTGCTGCTGTCGACGGATCTCGGGCCGGAAAGCGAGCC
AAGATTTGCCGGAGGTCTGGTATGA