SecReT6
Protein ID: 375132917
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00792
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]824049..825527 [-]
Producthypothetical protein
NoteTssC
UniProt IDF0LYK6
KEGG IDvfu:vfu_B00792
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.60E-165, Aligned region: 62..491
Protein Sequence: 492 a.a.     [Download]
>gi|375132917|ref|YP_005049325.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MSTELENQVSPEAGTESLSLLDRAIAATNQTPADQTKELFSVLAEQALSGTVTWDKNLTKTIENAIAEID
KQMSRQLSAIMQQDDFRRLEGSWRGLNKLVTESETGQSLKIKLVDFTKDELIEQFEDAPAVDRSPLFDAL
YQKEFGTAGGEPYGALIGDYTFSHKDEDVALMRYMGETAAASHAPFIAAANPEMFEFDSFETFNEGKPVA
SGFDSPAYASWNAFRESDDSRYVVLTLPQTLARLPYGDKGLGTKSFAYEELATDADGNPKPKNNAQLVWS
NAAYELGLKMTQAHTQFGWCTAIRGLDNGGKVENLPNLTYKSEAGDLMQQCPIEVNLTDEREKELSDLGF
LPLVHYKNTNYGVFIGSQTAQKPKTYTDPDATGNAAISARLPYIMASSRIAHYLKVMGRDMLGSNLEAAD
VQKDLQTWIDQYTNSGAVGNAERSKTPLCESRIQVVEQPGRPGAYSAVAHLRPWLQLEELTTSVRMVTKI
PG
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c825527-824049 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGAGTACTGAGTTAGAGAATCAGGTGAGCCCTGAAGCGGGTACCGAGTCACTCAGCCTGTTGGATCGCG
CGATTGCCGCGACCAACCAGACGCCGGCTGATCAAACCAAGGAACTGTTTTCCGTTCTGGCTGAACAAGC
GCTGAGCGGCACCGTCACTTGGGACAAAAACCTGACCAAAACCATCGAAAATGCGATCGCGGAAATCGAC
AAGCAGATGTCTCGTCAGCTGTCTGCGATCATGCAGCAGGATGATTTCCGTCGTCTGGAAGGGTCATGGC
GTGGTCTGAACAAGCTCGTCACTGAAAGTGAAACGGGTCAGTCGCTCAAGATCAAGCTGGTGGACTTCAC
CAAAGATGAACTGATTGAGCAATTTGAAGACGCACCTGCGGTTGACCGCAGCCCGCTGTTTGATGCGCTG
TATCAGAAAGAATTCGGCACGGCGGGTGGTGAACCTTACGGCGCGCTGATTGGTGACTACACCTTCTCGC
ACAAAGATGAAGATGTGGCGCTGATGCGTTACATGGGCGAAACCGCAGCGGCAAGCCACGCGCCATTTAT
CGCGGCGGCGAACCCAGAAATGTTTGAGTTTGACTCGTTTGAAACCTTCAATGAGGGGAAACCCGTTGCG
TCTGGTTTTGACTCGCCAGCCTACGCATCATGGAATGCTTTCCGTGAAAGCGATGATTCACGCTACGTGG
TGCTGACACTGCCTCAGACGCTGGCACGTTTGCCATACGGCGACAAAGGTCTGGGCACCAAATCGTTCGC
ATACGAAGAATTGGCAACCGACGCGGATGGCAATCCGAAGCCAAAAAACAATGCGCAACTGGTGTGGTCA
AACGCAGCTTACGAGCTGGGTCTGAAAATGACTCAGGCGCACACTCAGTTCGGCTGGTGTACCGCGATTC
GTGGTCTGGACAACGGTGGTAAAGTCGAGAACCTGCCAAACCTGACTTACAAGTCAGAAGCGGGCGATTT
GATGCAGCAGTGTCCGATTGAAGTCAACCTGACTGATGAGCGTGAAAAAGAGCTGAGCGATCTGGGCTTC
CTGCCACTGGTGCACTACAAAAACACCAACTACGGCGTGTTTATTGGCAGCCAAACTGCGCAGAAGCCAA
AAACGTACACCGACCCTGATGCAACGGGTAACGCGGCAATTTCTGCCCGTCTGCCTTACATCATGGCCAG
TAGCCGTATCGCACATTACCTGAAAGTGATGGGCCGTGACATGCTGGGTTCAAACCTGGAAGCGGCGGAC
GTGCAGAAAGATCTGCAAACCTGGATCGATCAGTACACCAACTCGGGTGCGGTGGGCAATGCAGAACGTT
CTAAAACGCCGCTGTGTGAATCTCGCATTCAAGTGGTGGAGCAACCGGGTCGTCCGGGCGCTTATTCAGC
AGTGGCGCATCTGCGTCCATGGCTACAACTGGAAGAGCTAACCACGTCTGTACGTATGGTTACTAAGATT
CCAGGCTAA