SecReT6
Protein ID: 375132918
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00793
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]825524..826030 [-]
Producthypothetical protein
NoteTssB
UniProt IDF0LYK7
KEGG IDvfu:vfu_B00793
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.10E-54, Aligned region: 7..160
Nif11 [PF07862], Evalue: 0.003, Aligned region: 122..167
Protein Sequence: 168 a.a.     [Download]
>gi|375132918|ref|YP_005049326.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MALNSQHKRVSKNRVSITYDVETNGAVETKELPFVVGVIGDFSAHKEDREELEDRTFYQIDKDNFDAVLN
RIGPELKLKVDNTLVEDGSQFEAALSFSSMKDFQPDALIEQVDPLKKLAETRQQLKTLLSKADRSRDLEK
LLKEVLQSADQINALSSELGLETKGEES
 
Nucleotide Sequence: 507 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c826030-825524 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
GTGGCTTTAAATTCTCAGCATAAACGTGTCAGCAAAAACCGGGTCAGTATTACTTACGACGTTGAAACGA
ATGGTGCCGTTGAAACCAAAGAACTTCCGTTTGTCGTCGGTGTGATCGGGGATTTTTCGGCGCACAAAGA
AGACAGGGAAGAGTTGGAAGATCGCACGTTCTACCAAATCGATAAAGACAACTTTGACGCCGTTCTGAAC
CGCATCGGTCCAGAACTGAAGCTAAAAGTGGACAATACGCTGGTTGAAGACGGCAGCCAATTTGAGGCTG
CGTTGTCCTTCTCCTCAATGAAGGATTTTCAGCCGGACGCGCTGATCGAGCAAGTTGATCCACTGAAGAA
ACTGGCTGAAACACGCCAGCAACTGAAAACCTTGCTGTCCAAGGCTGACCGTTCACGTGATCTGGAAAAA
CTGCTCAAAGAAGTCTTGCAAAGCGCAGACCAGATCAACGCGCTGTCCAGCGAACTGGGCCTTGAGACGA
AAGGAGAAGAGTCATGA