SecReT6
Protein ID: 375132920
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00795
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]826729..828063 [-]
Producthypothetical protein
NoteTssA
UniProt IDF0LYK9
KEGG IDvfu:vfu_B00795
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-14, Aligned region: 62..123
TPR_15 [PF13429], Evalue: 0.0083, Aligned region: 27..96
TPR_15 [PF13429], Evalue: 0.0083, Aligned region: 211..228
Protein Sequence: 444 a.a.     [Download]
>gi|375132920|ref|YP_005049328.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MFEHLLNPISDEHPSGEYLKDNRTLYRTYRNAFNVAQSSFRQLVETPDAMQDAVVVHTNAENWDALAKLC
ESCLSEQSKDVEIYSWFTMAQLFSASPLESLAQALHTLEQMIEHFWDSLQPTLPENKRKADGDAEQRKEV
AEHRVKPLLQLVGDSAESGLLYMPLQMLPLVGDIDYGRFFAAEKSGSLPQLKAAALADFSREKADVEARI
LALGASKDALHALETTLQQKCAAAGTQSINFRFVKEAVERLINAIHFLVGDQFARWPLDAAMTDAETPQA
ASEQTMAAVDSQSSEFAPTESAHQLTQGQSQPIMAQTAAPMAVPVASQEALASREQAFAELQRIADYFLA
TEPHSPIYLLLKRAIRWGGMSLPELLEELVGDNNAVQQRIEQLAGLESAQHQASRAAAPVATAPQMTMPE
AAPSVSPTSSTTNGSDSGLSAIEW
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c828063-826729 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTTTGAACATCTGCTCAACCCGATATCTGACGAACACCCGAGTGGCGAATATCTCAAAGATAATCGCA
CCTTGTATCGCACCTACCGGAATGCATTCAACGTTGCACAATCCTCGTTTCGCCAACTGGTAGAAACACC
GGATGCAATGCAGGACGCGGTGGTGGTCCACACCAACGCGGAGAACTGGGATGCCTTGGCCAAATTGTGT
GAAAGCTGTCTGTCTGAGCAGTCCAAAGATGTCGAAATCTACTCTTGGTTCACCATGGCGCAGCTCTTTT
CTGCCTCGCCTCTAGAATCCTTGGCGCAGGCGCTCCATACGCTGGAGCAGATGATTGAGCATTTCTGGGA
CTCACTCCAACCCACACTGCCGGAGAACAAACGCAAAGCAGACGGCGACGCCGAACAGCGCAAAGAAGTG
GCGGAACACCGCGTGAAGCCGCTGCTGCAACTGGTTGGCGATTCCGCTGAAAGTGGCTTGCTGTACATGC
CGCTGCAAATGCTGCCTCTGGTCGGCGACATTGATTATGGCCGTTTCTTTGCGGCAGAAAAATCGGGTTC
GTTGCCGCAGTTGAAAGCAGCCGCGCTGGCGGATTTTTCTCGTGAGAAGGCGGACGTGGAAGCGCGCATT
CTGGCACTCGGTGCAAGTAAAGATGCGTTGCATGCGCTGGAAACCACGCTGCAGCAGAAATGTGCGGCGG
CCGGTACCCAGTCGATTAATTTTCGCTTTGTGAAAGAGGCGGTCGAACGCCTGATCAACGCGATTCATTT
TCTGGTGGGCGATCAATTTGCCCGTTGGCCTCTGGACGCGGCGATGACTGACGCTGAAACGCCACAAGCC
GCGTCTGAGCAAACCATGGCCGCGGTTGACTCTCAATCCTCTGAATTTGCGCCAACTGAATCTGCCCATC
AGCTAACGCAGGGTCAGTCACAACCTATCATGGCGCAAACTGCGGCGCCGATGGCAGTACCTGTGGCATC
TCAGGAGGCGCTGGCGTCACGTGAACAGGCATTTGCCGAACTGCAACGCATTGCGGACTACTTTCTCGCC
ACCGAACCCCACAGCCCGATCTATCTGTTGCTGAAACGCGCGATTCGTTGGGGGGGGATGTCTCTGCCTG
AGCTGTTGGAAGAGCTGGTGGGCGACAACAACGCGGTGCAGCAACGCATTGAACAATTGGCCGGTCTGGA
AAGCGCGCAGCATCAGGCAAGCCGAGCGGCGGCGCCCGTTGCCACTGCACCACAAATGACGATGCCGGAG
GCTGCGCCTTCGGTATCTCCGACTTCATCGACGACAAACGGCAGCGACAGCGGTCTGTCAGCGATTGAAT
GGTAG