SecReT6
Protein ID: 375132924
SecReT6 ID529
T6SS typei5
Gene symbol-
Locus tagvfu_B00799
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]830102..832165 [-]
Producthypothetical protein
NoteTssI
UniProt IDF0LYL3
KEGG IDvfu:vfu_B00799
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-43, Aligned region: 30..335
Phage_base_V [PF04717], Evalue: 5.50E-26, Aligned region: 368..458
Phage_Mu_Gp45 [PF06890], Evalue: 0.0036, Aligned region: 4..48
Phage_Mu_Gp45 [PF06890], Evalue: 0.0036, Aligned region: 419..447
Phage_Mu_Gp45 [PF06890], Evalue: 0.0036, Aligned region: 535..586
Phage_Mu_Gp45 [PF06890], Evalue: 0.0036, Aligned region: 609..633
DUF2345 [PF10106], Evalue: 0.0037, Aligned region: 545..591
DUF2345 [PF10106], Evalue: 0.0037, Aligned region: 609..645
Protein Sequence: 687 a.a.     [Download]
>gi|375132924|ref|YP_005049332.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MNELIDAQGSYLVVQDANGNEFVASTLSVTEQINQHYEWQADIIVSDSSPADWIGTEVSCSVYNVIGDSR
TSLRQYQGYVVKAQAQSQRIDSSYYGIKLTVQPWLFLLKHSRQCRVFQEQTAQDIVTSIFDELGFSGQYT
VNSMPSTSREYCVQFGESDFEFVTRLLAEDGVHFYFGKDANAAKLYLQEAQMSFEQSDMATLDYAAAPSG
DYDVLETWQREYAFHSASLEIAGYDYSQSKVVTSGAKASSYAVSGNTKLKEYRYPTASITNDSSSLTSTL
GTLQRGQLDSGYDRVHAKTPSADLCVGQYLKLAAHSDSAEEGNYLVTELHYQFENQKGNAFSAQAELVCV
PEDQVFYPPAKARPILHGLQSAVVAGSTESEPASDTSGRVRIKFHWDDETGDKTSCWVRVAQGMAGSGYG
MQFLPRAGQEVLVSFINGDPDQPVVVASVYNSTNTPPYPTENTTESGVKTKLAGESNELRFDDKKDNELL
YLHAAKDFTSEVVNDHSETVGGEMTLAVTKNLTETIEQSHSLSAKEGITLTTEKSYALTVTESITQDGKD
ITLTGSDSLTLKVGDSSIVMSSDKIEISSSTIALTADSAISLSGGDISQSGDSISLDSDGSLSASSGSSM
SLSAGSSFTASASSSATVSGLNATLSADVTATVSGSATAELSSDGQASISGTLVMVN
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|375132168|ref|NC_016628.1|:c832165-830102 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGAATGAATTGATTGATGCGCAAGGCAGCTATCTGGTGGTTCAGGACGCCAACGGCAATGAGTTTGTGG
CTTCAACCCTGAGTGTGACTGAGCAGATCAACCAGCACTATGAGTGGCAAGCCGACATCATCGTGTCGGA
TTCTTCGCCCGCGGATTGGATTGGCACTGAAGTCAGCTGCTCGGTCTACAACGTGATTGGCGATTCGCGC
ACTAGCCTGCGTCAGTACCAAGGCTATGTGGTGAAAGCACAGGCTCAGTCGCAACGGATTGATTCCAGTT
ACTACGGCATCAAACTGACCGTTCAGCCATGGCTGTTCCTGCTCAAGCATTCACGCCAGTGCCGCGTATT
TCAGGAGCAAACCGCGCAGGACATCGTGACGTCCATTTTCGATGAGCTGGGCTTTAGCGGTCAGTACACC
GTCAACAGCATGCCATCGACCAGTCGTGAATATTGCGTGCAGTTCGGTGAGTCGGATTTTGAGTTTGTCA
CGCGCTTACTTGCTGAAGATGGCGTGCATTTTTACTTCGGCAAAGATGCCAACGCGGCAAAGCTCTATCT
GCAGGAAGCGCAGATGTCGTTTGAACAAAGCGACATGGCGACGCTGGATTACGCCGCTGCGCCATCGGGT
GATTACGACGTGTTGGAGACGTGGCAGCGTGAGTATGCGTTTCACAGCGCCTCACTGGAAATTGCTGGTT
ACGACTACTCACAATCGAAAGTGGTGACGAGTGGCGCCAAGGCGTCGAGCTACGCTGTTTCTGGCAACAC
CAAACTCAAAGAGTACCGTTATCCGACGGCATCGATCACCAATGATTCCAGTAGCCTGACCTCAACCCTT
GGCACGCTGCAGCGTGGCCAGCTCGATTCTGGCTATGACCGCGTTCACGCCAAGACACCATCGGCAGATT
TGTGTGTCGGTCAGTATTTGAAACTGGCGGCGCATTCAGACAGTGCTGAAGAAGGCAACTATCTGGTGAC
CGAGCTGCATTACCAGTTTGAAAACCAAAAAGGTAATGCGTTCAGCGCGCAAGCTGAGTTGGTGTGTGTG
CCAGAAGATCAGGTGTTCTATCCGCCCGCGAAAGCTCGGCCCATATTACACGGCCTGCAATCTGCGGTTG
TGGCGGGCAGTACCGAGAGTGAACCTGCCAGTGATACGTCGGGTCGCGTGCGGATCAAATTCCACTGGGA
TGATGAAACCGGCGACAAAACCAGTTGCTGGGTTCGCGTTGCCCAAGGCATGGCTGGTAGCGGCTACGGC
ATGCAATTTCTGCCACGCGCGGGTCAGGAAGTACTGGTGAGTTTTATCAACGGTGACCCGGATCAGCCCG
TGGTGGTGGCGAGTGTCTATAACTCGACCAACACACCGCCATACCCAACGGAAAACACCACTGAAAGCGG
CGTGAAAACCAAGCTGGCGGGCGAGTCAAACGAGCTGCGTTTCGACGACAAGAAAGACAACGAGCTGCTG
TATCTGCACGCCGCCAAGGATTTCACCAGTGAAGTTGTGAACGATCATAGCGAAACCGTCGGTGGAGAAA
TGACCTTGGCGGTCACCAAGAACCTGACGGAAACCATTGAGCAGTCACACAGCTTGTCTGCCAAAGAGGG
CATCACGCTGACGACGGAAAAATCGTATGCGCTGACGGTGACTGAGTCGATCACGCAAGACGGCAAAGAC
ATCACCCTCACGGGCAGTGATTCACTGACCTTAAAAGTGGGTGACAGCAGCATTGTGATGAGCAGCGACA
AGATTGAGATTTCCAGCAGCACCATCGCGTTAACCGCGGATTCTGCCATTTCTCTGTCGGGTGGCGACAT
CAGTCAATCGGGTGATTCGATCAGTCTCGATTCCGATGGGTCTTTGAGCGCGTCGTCGGGCAGTTCGATG
TCTCTGAGTGCGGGCAGCAGCTTTACCGCGTCCGCCAGCAGTTCGGCCACCGTGTCTGGCCTCAACGCGA
CACTGAGCGCAGATGTCACCGCGACCGTGTCGGGCAGTGCGACGGCGGAACTGAGTTCTGATGGTCAGGC
GTCTATCAGCGGCACATTGGTGATGGTGAACTAA