SecReT6
Protein ID: 375133276
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01176
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1232863..1233372 [+]
Producthypothetical protein
NoteTssB
UniProt IDF0LZL5
KEGG IDvfu:vfu_B01176
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-58, Aligned region: 5..158
Protein Sequence: 169 a.a.     [Download]
>gi|375133276|ref|YP_005049684.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MSKEGSVAPKERINIKYIPATGDTQAEVELPLKTLVVGDFKGHSEETPVEERSTVSVDKNNFEAVMRESN
LKLTTTVKNKLGEDETADLPVELNFKSLADFSPDSVASQVPELKKLIELREALVALKGPLGNIPAFRERL
QDLLNSEESREKLLAELNLVSESEEETQA
 
Nucleotide Sequence: 510 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1232863-1233372 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTCTAAAGAAGGAAGTGTAGCTCCGAAAGAGCGCATTAATATTAAGTATATTCCTGCGACTGGGGATA
CACAGGCTGAAGTGGAATTGCCATTGAAAACCTTAGTGGTTGGTGATTTCAAAGGTCATTCAGAAGAGAC
GCCAGTTGAAGAGCGCTCAACCGTTTCTGTGGATAAGAACAACTTTGAAGCGGTGATGCGTGAAAGCAAT
CTGAAACTGACCACCACCGTGAAGAACAAACTGGGTGAAGATGAGACTGCCGATTTACCGGTTGAGCTGA
ACTTCAAATCCCTTGCGGATTTCTCCCCAGATTCTGTCGCTTCACAAGTTCCTGAATTAAAAAAATTGAT
TGAGTTACGCGAGGCGCTCGTCGCGCTGAAAGGCCCGCTGGGTAATATTCCTGCGTTCCGTGAGCGCCTG
CAAGATCTGCTGAACTCGGAAGAGTCACGCGAGAAACTGCTGGCAGAACTCAATCTTGTTAGTGAATCAG
AAGAAGAAACTCAAGCCTAA