SecReT6
Protein ID: 375133278
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01178
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1234897..1235334 [+]
Producthypothetical protein
NoteTssE
UniProt IDF0LZL7
KEGG IDvfu:vfu_B01178
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-19, Aligned region: 37..124
Protein Sequence: 145 a.a.     [Download]
>gi|375133278|ref|YP_005049686.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MTYIAPEESAFGVGFFERLEANAKPMSLTQGPDAWDVLESVKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETMDLSLRIKLAIQHCLERYEPRLKQVLVRADSDHFNPLTLRFHIVASINCDALHKKVQFSLLLDQNR
KYRVF
 
Nucleotide Sequence: 438 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1234897-1235334 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGACTTACATTGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTCTTTGAACGTTTAGAAGCCAATGCTA
AACCCATGTCTCTGACCCAAGGGCCAGATGCATGGGATGTACTCGAATCCGTTAAGCGTAATGTGTCCAA
TATCCTCAATACACGAATCGGTGGTGCGCAAAGCGCGCCGCATCTCGGGTTAGTGGATTTTAACGACGCC
ACCTTAGAAACCATGGATCTGTCGCTGCGTATCAAACTGGCGATTCAGCATTGTCTGGAACGCTATGAGC
CACGTTTAAAGCAGGTACTGGTGCGCGCCGATTCGGACCATTTCAATCCTTTAACGCTGCGTTTCCACAT
TGTGGCCAGCATTAACTGCGATGCATTACACAAGAAAGTTCAGTTCAGTCTGTTACTGGATCAAAACAGA
AAGTATCGAGTGTTTTAA