SecReT6
Protein ID: 375133279
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01179
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1235340..1237109 [+]
Producthypothetical protein
NoteTssF
UniProt IDF0LZL8
KEGG IDvfu:vfu_B01179
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-209, Aligned region: 5..589
Protein Sequence: 589 a.a.     [Download]
>gi|375133279|ref|YP_005049687.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MTQDKYFREELAFLKEQGREFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSI
INMLWPNYLRPVPSMSVVAFTPDKSVSERQTIARGTQLDSKPVFGTKCHFRTCRDVALYPLHCLDANAEH
TREATIIKLTMKMNGDISIGDAELGDLRFYLGGDKYSSQMLYLWLNHYLEKVSVEVNGAVFTLPRNAFAT
VGFHSDESLLPYPTNVYEGYRILQEYLSFPEAFHFFDLKGLGQALPKSVHGEFTLHIHLSKTLPADVRVR
KDNFQLYCTPVINLFEHDADPIDLNGRKSEYRIVPSSRYPAHYEVFSVDSVVGWQDNSQAGQRVRGEKRV
YSSFESFQHEVERVRHRQALYYRTRIKESIRGDGFDSFVSFIRGDETLSVDVDEAVSIKLTCTNRLLPLE
LGVGDICEPTDTSPPYATFRNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSCVLRAYDFRAL
VDRQAERVARLRMDGISKIESQPVDKMLRGLPVRGLQSTLYIDQAGFGSEGDLYLFGTVLSHFFALYASI
NSFHELVVINVSNQEKYTWGTQTGMQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1235340-1237109 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGACTCAAGACAAGTATTTCAGGGAAGAGCTCGCTTTTCTTAAAGAGCAGGGGAGAGAATTTACCGAAA
TTCACCCTCAGCTGTCGCGCTTTCTGCATGGCAGAACAACCGACCCAGACGTAGAGCGTCTGTTGGAAGG
CTTTGCGTTCCTGACTGCGCGTCTGCGTGAAAAAGTCGAAGATGAGTTCCCTGAACTGACGCACTCGATC
ATCAATATGCTGTGGCCGAACTATTTGCGGCCTGTGCCGAGCATGAGCGTGGTGGCCTTTACACCGGACA
AAAGTGTCAGTGAAAGACAGACGATTGCTCGCGGCACTCAACTGGATAGCAAACCGGTGTTTGGCACCAA
GTGTCATTTTCGAACCTGCCGCGATGTGGCGCTCTATCCGCTTCATTGTCTGGATGCCAACGCGGAACAC
ACGCGTGAAGCCACCATCATTAAGCTGACAATGAAGATGAACGGCGACATTTCAATTGGTGATGCTGAGC
TGGGTGATTTGCGTTTTTACCTCGGCGGAGACAAGTACAGTTCGCAAATGTTGTATCTGTGGCTCAATCA
CTATTTGGAAAAAGTCAGTGTTGAAGTGAATGGGGCCGTCTTTACGCTGCCGCGCAATGCGTTTGCAACC
GTGGGCTTTCACAGCGACGAATCGTTATTGCCTTACCCAACCAATGTTTACGAAGGTTACCGCATTTTGC
AGGAGTACCTGTCATTTCCGGAAGCATTCCACTTTTTTGATCTCAAGGGTTTGGGGCAAGCGCTGCCAAA
ATCGGTGCACGGTGAATTCACGTTGCACATCCATTTATCCAAAACATTACCCGCTGATGTGCGTGTGCGC
AAAGACAACTTTCAGCTCTATTGCACACCAGTGATCAACCTCTTCGAGCACGATGCTGACCCCATCGACC
TCAATGGTCGTAAATCGGAATACCGCATTGTGCCATCCAGCCGCTATCCGGCGCATTACGAAGTGTTTAG
CGTCGACAGCGTGGTGGGTTGGCAGGACAACAGCCAAGCGGGTCAACGAGTACGTGGCGAGAAGCGTGTG
TACTCCTCGTTTGAAAGCTTTCAACACGAAGTTGAACGTGTTCGTCATCGTCAGGCGTTGTATTACCGCA
CACGGATTAAAGAAAGCATTCGCGGTGACGGCTTTGACTCATTTGTGTCCTTTATTCGCGGCGATGAAAC
CCTGTCGGTTGATGTGGATGAAGCGGTGTCCATCAAACTGACCTGCACCAACCGTTTGTTACCGTTGGAG
CTGGGTGTGGGCGACATTTGTGAGCCAACCGACACCTCGCCGCCGTACGCGACGTTTCGCAACATCACCG
TGCCGTCGCAGTCGCTGCGTCCGGTGCTCGATGGCAGCCTGCTGTGGACGCTGATTTCCAACTTGTCACT
CAACTACTTGTCGTTGCTATCCAAAGATGCGCTTAGCTGTGTGCTGCGGGCTTACGATTTCCGCGCGTTG
GTGGATCGCCAAGCTGAGCGTGTGGCGCGTCTGCGCATGGATGGCATCAGTAAAATCGAATCGCAACCGG
TAGACAAAATGCTGCGCGGCTTACCCGTACGCGGCCTGCAATCGACCCTTTACATTGATCAAGCAGGGTT
TGGTTCGGAAGGTGATTTGTATCTGTTTGGCACGGTGCTGAGTCATTTCTTTGCGCTCTACGCCAGTATC
AATTCGTTTCACGAATTGGTCGTCATCAACGTGAGTAACCAAGAGAAGTACACATGGGGAACACAGACCG
GAATGCAGCCGTTGATATGA