SecReT6
Protein ID: 375133280
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01180
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1237106..1238089 [+]
Producthypothetical protein
NoteTssG
UniProt IDF0LZL9
KEGG IDvfu:vfu_B01180
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.00E-95, Aligned region: 17..313
Protein Sequence: 327 a.a.     [Download]
>gi|375133280|ref|YP_005049688.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MTADGQLVPQLHLPGDVRAYNFYQLVELLQKLQQFNPESEEWERQCQLVFSANPSLGFSPSDVNSLHERD
DERLVMLTNFFGLSGAQSPLPGFIIEQLVNEEPGGFKQPFFDFFNNRLINLVYRIWRKYRYYVRFQPDAQ
DAFSTQLFALVGLGDTDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLQDVSIRQWVRRKVQ
IDKSQQLSLGQQNAQLGVDSMVGESVMDCNGKFVICIGKLSRERFADFLPSGKEHQPLCKLVEFILREQM
AYDVELTLDEDEAPKLSLAADSGVALGWTSFLGDNAQDQHVLIQVRQ
 
Nucleotide Sequence: 984 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1237106-1238089 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGACGGCTGACGGCCAGCTGGTGCCCCAATTGCACTTGCCTGGTGATGTACGTGCTTACAACTTTTACC
AGTTGGTTGAGTTGTTGCAAAAACTGCAGCAATTCAACCCTGAATCGGAAGAGTGGGAGCGTCAGTGTCA
GTTGGTGTTTAGTGCCAACCCAAGCTTGGGGTTTTCGCCATCTGATGTGAATTCTCTGCATGAGCGTGAC
GATGAACGTTTGGTGATGCTGACCAACTTTTTTGGTTTGTCTGGCGCGCAGTCGCCGCTGCCCGGGTTCA
TCATCGAACAATTGGTCAACGAAGAACCGGGCGGGTTCAAACAGCCATTTTTTGACTTTTTTAATAACCG
ATTGATCAACTTGGTGTATCGCATCTGGCGCAAATATCGTTATTACGTGCGTTTTCAGCCAGATGCGCAA
GATGCGTTTTCTACCCAGTTGTTCGCGTTGGTGGGATTGGGTGATACCGACCTGCGCGGCGAGACGCCCA
TCAACTGGTGCAAGATGCTGGCTTACGCCGGTACCTTGGCAGGACGCAGCCGCTCACCGCAAGTGGTGGC
TGGCATCATCGCCCACTGTTTCGATTTGCAAGACGTGAGCATTCGCCAGTGGGTGCGCCGCAAGGTGCAG
ATCGACAAATCCCAGCAACTGTCGCTGGGACAACAGAATGCCCAACTGGGCGTTGACAGCATGGTGGGTG
AATCGGTGATGGACTGCAACGGTAAGTTCGTCATATGCATTGGAAAGTTGTCGCGCGAGCGTTTCGCCGA
TTTTCTTCCTTCCGGTAAGGAACACCAACCGCTGTGCAAATTAGTGGAATTTATTTTGCGTGAGCAGATG
GCCTACGACGTCGAGCTGACCCTGGATGAAGATGAAGCGCCCAAATTGAGCTTGGCGGCCGATAGTGGCG
TAGCTCTGGGATGGACTTCGTTTCTGGGAGACAACGCGCAAGACCAACACGTTCTGATTCAAGTGAGGCA
ATAA