SecReT6
Protein ID: 375133281
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01181
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1238093..1239580 [+]
Producthypothetical protein
NoteFha
UniProt IDF0LZM0
KEGG IDvfu:vfu_B01181
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 9.50E-07, Aligned region: 36..102
Protein Sequence: 495 a.a.     [Download]
>gi|375133281|ref|YP_005049689.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MNAMTQTSLILQVANVQLLESGLTAQSHWTPEGGNIGSESWATWRLKDAQGRVKPQHCAIVSIDGAFCVR
DLCGDTYVNGSHMPLGKDQLAKLEHRDEITVGPYQLRVSFGHADEHDRNAGPLDAMFKADQVDLLADDPF
DDEALEDEAPLAANADPLLALDALLEAKDDAEALLRDVERLDDSDQSHALVPEENLVLHDLKFTPQADSE
YEMTSSIRLKKILGFGPRKDDVAQPDIAPAHQPQSPQQTTTAPSSPINTHNVSEGLTMDEKVLDLLEEEV
ARSLQPANADTATSSAGGKHLLTGPMLQGLGIDLSQDTDMERMHFLSQELGESLQACVKGLLELHQQVSD
GRFGTMNRNLQPIEDNPLRLGLSYEQTIRTMYDADKSLVHLSAPAAISESLKNVRDHNEAMQHATSEALN
QILNAFSPQVLLRRFHHYKRNTDTSATSDEAWAWNMYCNYYQELTSNRQRGFEKLFWEIFEQAYDKKIRE
KQLEL
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1238093-1239580 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGAACGCAATGACTCAGACGTCACTGATCCTTCAAGTGGCCAACGTACAACTGCTCGAATCGGGTTTGA
CCGCCCAATCGCACTGGACGCCAGAAGGCGGCAATATTGGCTCCGAATCATGGGCAACTTGGCGACTCAA
AGACGCGCAAGGCCGCGTGAAACCTCAGCATTGTGCCATTGTCTCGATTGATGGCGCGTTTTGTGTCCGT
GATTTGTGTGGTGACACCTATGTGAATGGTTCACACATGCCGCTGGGTAAAGATCAGTTAGCAAAGCTGG
AGCATCGAGACGAAATCACCGTGGGGCCTTATCAGCTACGAGTTTCGTTTGGTCATGCGGATGAGCACGA
CCGCAATGCTGGCCCGTTGGATGCGATGTTTAAAGCGGATCAGGTCGATCTGCTGGCGGATGACCCCTTC
GATGATGAAGCACTAGAAGACGAGGCACCGCTTGCGGCGAATGCTGATCCGCTCTTGGCACTGGATGCGC
TACTTGAGGCCAAAGACGACGCCGAAGCGCTGCTGCGCGATGTGGAACGACTAGACGACAGTGACCAGTC
GCATGCATTGGTGCCGGAAGAGAACTTGGTGCTTCATGATTTGAAATTTACCCCGCAGGCAGACAGCGAG
TACGAAATGACGTCATCCATTCGATTGAAAAAAATTCTGGGCTTTGGCCCGCGTAAAGACGATGTCGCGC
AACCGGACATCGCGCCAGCGCATCAGCCTCAGTCACCACAACAAACAACAACAGCACCATCATCACCAAT
CAACACTCACAACGTATCAGAGGGCTTAACAATGGATGAAAAAGTATTGGATCTTCTTGAAGAAGAAGTC
GCCAGAAGTCTGCAACCTGCCAACGCCGACACTGCCACAAGTTCTGCGGGTGGCAAACATTTGCTGACCG
GCCCAATGCTGCAGGGGCTGGGGATCGATCTCAGTCAGGACACTGACATGGAACGCATGCACTTCTTGTC
TCAAGAATTGGGTGAGTCGCTGCAGGCGTGTGTGAAAGGCTTGCTGGAACTGCATCAACAAGTGAGTGAC
GGTCGCTTCGGAACCATGAACCGCAACCTGCAACCCATTGAAGATAACCCGCTGCGCTTGGGTCTGTCTT
ATGAACAAACCATTCGCACCATGTACGATGCCGACAAGAGTTTGGTCCACCTCTCTGCACCGGCGGCGAT
TTCAGAAAGCCTGAAGAACGTCCGCGACCACAACGAAGCGATGCAACACGCCACCTCGGAAGCGCTGAAT
CAGATTCTGAACGCCTTCTCTCCACAAGTGTTGCTGCGCCGCTTCCATCACTACAAACGTAATACAGACA
CCAGTGCCACTTCGGATGAAGCGTGGGCGTGGAACATGTACTGCAACTACTACCAAGAGCTGACTTCCAA
CCGTCAACGCGGTTTTGAAAAGCTGTTCTGGGAAATTTTCGAACAGGCTTACGACAAGAAAATTCGTGAG
AAGCAACTGGAGCTCTAA