SecReT6
Protein ID: 375133283
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01183
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1240066..1241400 [+]
Producthypothetical protein
NoteTssK
UniProt IDF0LZM2
KEGG IDvfu:vfu_B01183
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-160, Aligned region: 19..443
GMP_synt_C [PF00958], Evalue: 0.00039, Aligned region: 27..46
GMP_synt_C [PF00958], Evalue: 0.00039, Aligned region: 120..142
GMP_synt_C [PF00958], Evalue: 0.00039, Aligned region: 303..374
Protein Sequence: 444 a.a.     [Download]
>gi|375133283|ref|YP_005049691.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MFARNRVIWNEGLFIKPQHFQQQQRYVEYHIDERMTAVSRYLYGVSELSLNPEYLSFGRIAIERAVGIMP
DGTAFRIPQEDAMPDALEIDDASLANQLVYLAVPLRSESLMEVNWPEERGTGRYVSRRLEVRDVHTVQGD
TTTIDVSPVRMQLMLEKEDRSSFASIAIARILEKRPDGSVVMDPDFIPCHLNVVGNAALHRFINEMSGLM
RERAKNIAQRISAPSQGGVADVSDFMLLQALNRLQPQMQHLAELRSLHPERLFECLASVCGELATFTDES
RLPPTLPSYNHDMPSQSFGPLIRNLRQSLSVVLEPRAVSIQLDKRKYGLMVAPVHDPQLMDSAEFIIAVK
ARMPLDELRRLFTQQTKVSSVEKIRELISLQLPGIPLISLPVAPRQLPYHAGYTYYQLDKTSPAWAMLNH
SSGFAFHVAAAFDDLDLQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1240066-1241400 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTTTGCGCGTAACCGAGTCATTTGGAATGAGGGGCTATTTATCAAGCCGCAACATTTCCAGCAGCAGC
AACGTTATGTGGAGTACCACATCGACGAGCGCATGACCGCTGTCAGCCGTTATCTGTATGGCGTGTCTGA
GCTGTCACTCAATCCTGAATATCTGTCGTTTGGTCGCATCGCCATTGAACGCGCGGTCGGCATCATGCCC
GATGGCACCGCGTTTCGGATTCCGCAAGAAGATGCGATGCCAGACGCCTTAGAAATCGACGATGCGTCGC
TGGCGAACCAACTGGTGTATCTGGCGGTGCCGCTACGCAGTGAATCGCTGATGGAGGTCAACTGGCCGGA
AGAGCGAGGCACCGGGCGCTATGTCAGTCGCCGCTTAGAAGTGCGTGACGTGCACACCGTGCAGGGCGAT
ACCACGACCATCGATGTCTCGCCGGTGCGCATGCAACTGATGCTGGAAAAAGAAGATCGCAGCTCATTTG
CCTCCATCGCCATTGCGCGCATTCTGGAAAAACGCCCGGACGGCAGCGTGGTCATGGACCCGGATTTCAT
CCCTTGCCACCTCAACGTGGTCGGCAATGCTGCGCTGCACCGTTTCATCAATGAAATGTCGGGCTTGATG
CGCGAGCGCGCCAAGAACATTGCGCAGCGGATCAGCGCGCCATCGCAAGGCGGCGTTGCCGATGTGTCGG
ACTTTATGTTGTTGCAAGCCCTGAACCGCCTACAGCCACAGATGCAACATCTGGCAGAGCTGCGCAGCCT
GCATCCCGAACGTTTGTTTGAATGCTTGGCGTCCGTGTGTGGTGAGTTGGCCACATTTACAGACGAAAGC
CGTCTGCCGCCAACGTTGCCAAGTTACAACCACGACATGCCCAGTCAGTCGTTTGGTCCCTTAATTCGCA
ATCTGCGTCAGAGCTTGAGCGTGGTGCTGGAGCCTCGCGCCGTTTCGATTCAACTGGACAAACGCAAGTA
CGGCCTGATGGTCGCGCCGGTGCACGATCCGCAGTTGATGGACAGCGCCGAATTTATTATTGCGGTGAAA
GCACGAATGCCGCTCGACGAACTGCGTCGCCTATTTACCCAACAGACCAAAGTGTCATCGGTGGAAAAAA
TTCGCGAACTGATTTCCCTGCAATTGCCAGGTATCCCGTTGATTTCATTGCCAGTGGCGCCTCGTCAGTT
GCCGTATCACGCGGGATACACCTATTACCAGCTGGATAAAACCAGCCCAGCATGGGCGATGCTGAATCAT
TCGAGCGGCTTTGCGTTCCACGTCGCAGCAGCATTTGATGATCTCGACCTGCAATTCTGGGCGATTAGGA
GTTAA