SecReT6
Protein ID: 375133284
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01184
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1241403..1242176 [+]
Producthypothetical protein
NoteTssL
UniProt IDF0LZM3
KEGG IDvfu:vfu_B01184
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.50E-70, Aligned region: 37..242
Protein Sequence: 257 a.a.     [Download]
>gi|375133284|ref|YP_005049692.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MALSKKETQYSSLLFDDVQQINHDQDFWFQLRGDNPNVLIDAATPLFGLSLRVRSLAACDNIEQIYNQTI
EEIKAIEIELAEQGFEHAILMAYRYILCAFLDEAVMGTEWGASSVWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPKRYQALLEFIYQCLVLGFEGKYRVMDGGQLEREKVIARLHDVLASLEEEEPQDLTRATDHVVRA
KYKLSRQLPIWSIFAGFALLWVGLFLGYTYLLHSKSSDVLNQLNQIL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1241403-1242176 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGGCGTTAAGTAAAAAAGAGACCCAATACAGCAGCTTGCTCTTCGATGACGTGCAGCAGATCAACCATG
ATCAGGACTTCTGGTTCCAGCTGCGTGGCGATAATCCCAATGTGTTGATCGATGCAGCGACGCCGCTGTT
TGGCTTGTCACTGCGCGTCCGTTCTTTGGCAGCCTGCGACAACATTGAGCAAATCTACAACCAGACCATT
GAAGAGATCAAAGCTATCGAGATTGAGCTGGCTGAACAAGGCTTTGAGCACGCGATTTTGATGGCGTATC
GCTACATCCTATGTGCGTTTCTGGATGAAGCGGTGATGGGCACCGAATGGGGTGCATCCAGCGTATGGGC
GGAGCATTCCATGTTGTCGCGTTTTCACAATGAAACGTGGGGCGGTGAAAAAGTATTCACGATTCTGAGC
CGTTTGGAAGGCGAACCGAAGCGTTATCAGGCACTGCTGGAATTCATTTATCAATGTTTGGTGTTGGGCT
TTGAAGGCAAATACCGGGTGATGGATGGTGGCCAACTGGAACGTGAAAAGGTCATTGCCCGTTTGCATGA
TGTGCTCGCGAGTCTTGAAGAGGAAGAACCGCAGGATCTCACGCGAGCCACCGACCATGTTGTGCGCGCC
AAATACAAACTGAGCCGTCAGTTGCCGATTTGGTCGATTTTTGCCGGTTTTGCCCTGCTGTGGGTCGGAC
TCTTTCTCGGCTATACCTATTTGCTGCACAGCAAATCAAGCGACGTGTTAAATCAACTCAATCAAATACT
TTAA