SecReT6
Protein ID: 375133285
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01185
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1242203..1244815 [+]
ProductclpB protein
NoteTssH
UniProt IDF0LZM4
KEGG IDvfu:vfu_B01185
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-38, Aligned region: 223..239
AAA_2 [PF07724], Evalue: 2.00E-38, Aligned region: 608..769
AAA [PF00004], Evalue: 1.60E-19, Aligned region: 222..353
AAA [PF00004], Evalue: 1.60E-19, Aligned region: 614..732
AAA_5 [PF07728], Evalue: 4.10E-13, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 4.10E-13, Aligned region: 613..732
ClpB_D2-small [PF10431], Evalue: 7.00E-13, Aligned region: 775..849
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 80..110
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 200..237
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 357..396
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 466..535
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 584..654
AAA_22 [PF13401], Evalue: 2.20E-10, Aligned region: 131..158
AAA_22 [PF13401], Evalue: 2.20E-10, Aligned region: 221..314
AAA_22 [PF13401], Evalue: 2.20E-10, Aligned region: 610..700
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 222..255
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 278..319
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 449..492
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 608..646
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 136..169
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 222..323
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 612..695
DUF258 [PF03193], Evalue: 2.90E-05, Aligned region: 187..240
DUF258 [PF03193], Evalue: 2.90E-05, Aligned region: 613..654
Arch_ATPase [PF01637], Evalue: 4.70E-05, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 4.70E-05, Aligned region: 274..308
Arch_ATPase [PF01637], Evalue: 4.70E-05, Aligned region: 613..653
NACHT [PF05729], Evalue: 0.00017, Aligned region: 222..250
NACHT [PF05729], Evalue: 0.00017, Aligned region: 614..642
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 216..343
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 612..631
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 609..624
Clp_N [PF02861], Evalue: 0.00033, Aligned region: 24..72
AAA_17 [PF13207], Evalue: 0.00055, Aligned region: 222..269
AAA_17 [PF13207], Evalue: 0.00055, Aligned region: 460..460
AAA_17 [PF13207], Evalue: 0.00055, Aligned region: 614..648
AAA_19 [PF13245], Evalue: 0.002, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.002, Aligned region: 610..635
Sigma54_activat [PF00158], Evalue: 0.0027, Aligned region: 221..236
Sigma54_activat [PF00158], Evalue: 0.0027, Aligned region: 611..711
DUF815 [PF05673], Evalue: 0.0035, Aligned region: 218..297
DUF815 [PF05673], Evalue: 0.0035, Aligned region: 567..647
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 222..242
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 614..653
Miro [PF08477], Evalue: 0.0045, Aligned region: 223..239
Miro [PF08477], Evalue: 0.0045, Aligned region: 614..636
MobB [PF03205], Evalue: 0.0055, Aligned region: 222..241
MobB [PF03205], Evalue: 0.0055, Aligned region: 613..635
Ras [PF00071], Evalue: 0.0057, Aligned region: 222..235
Ras [PF00071], Evalue: 0.0057, Aligned region: 614..655
RNA_helicase [PF00910], Evalue: 0.0058, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.0058, Aligned region: 614..636
Protein Sequence: 870 a.a.     [Download]
>gi|375133285|ref|YP_005049693.1| clpB protein [Vibrio furnissii NCTC 11218]
MIRIELPTLISKLNAQSKLALEQAASLCIERQHPEVTFEHYLDVLTDNPLSDVRLILKQANLELDTVKQA
LAASYAREQVLDTYPAFSPLLVELLQEAWLLSTTELDQSELRSGAIFLAAITRADRYLPFKLISLFESIN
RENLKKHFDVIVADSAETEVSKPTATQGAANRLEGNNSPLTKYCTNVTEQARNQELDPVLCRENELNLMI
DILCRRRKNNPIVVGDAGVGKSAMIEGLALRVVAGTVPTQLQNVELLSLDLGLLQAGASVKGEFEKRLKG
VIDAIKSSPKPVILFIDEAHTLIGSGNQEGGSDAANLLKPALARGELSTVAATTWKEYKKYFEKDPALTR
RFQLVKLEEPTIPQAVDILRGLNSVYEKAHNVLITDDALKAAAELSARYISGRQLPDKAIDVLDTACARI
AINMTTPPKRLALLETACHQRQLEIDMLERAQYLGRDVDHARLDELRTQELADEAEKAALTASWQQQKEL
IESIISLRAELMAMSTADDVEEDARAALQAELNTQYQTLAAIAHHERLMHPQVDAEQIAEVIADWTGVPV
DQMNTDELHKITHLTDILGAAIKGQDTAIERVHRHLLTARADLRRPGRPKGAFLLVGPSGVGKTETVVQL
AEQLYGGKQFLTTINMSEYQEKHTVSRLIGSPPGYVGYGEGGILTEAIRKMPYSVVLLDEVEKAHPEVLN
IFYQAFDKGELADGEGRLIDCQNIVFFLTSNLGYQTIVDFADDPKALDEALYPELAAFFKPALLARMEVI
PYMPLNKAILELIVKGKLARLEKLFRDRYNAEVVIEDRLIEEILNRATRSENGARMLEAIIEGQLLPPVS
LALLNKLAEKQPVHRIHLDALDGEFKGEVA
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1242203-1244815 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
GTGATTCGTATTGAACTACCCACTCTGATTTCAAAATTAAACGCCCAAAGCAAGCTGGCTCTTGAACAGG
CGGCCTCGCTGTGTATCGAACGTCAGCATCCGGAAGTGACGTTTGAACATTATTTGGATGTATTGACGGA
CAACCCGTTGTCGGATGTGCGCTTGATTCTGAAACAAGCCAATCTGGAACTGGATACCGTAAAACAAGCT
TTGGCCGCCAGCTATGCGCGCGAACAAGTGCTCGATACGTATCCAGCATTTTCCCCCTTGCTGGTCGAGC
TGTTGCAAGAAGCATGGCTGCTTTCCACCACCGAACTGGACCAAAGCGAATTGCGCTCGGGGGCAATTTT
TCTTGCGGCAATCACACGCGCTGACCGTTATCTGCCTTTCAAACTGATCAGTCTGTTTGAAAGCATTAAC
CGTGAAAATCTGAAAAAACATTTTGATGTGATTGTGGCTGATTCGGCAGAAACTGAAGTCAGTAAACCCA
CAGCAACGCAGGGCGCCGCCAATCGTCTGGAAGGGAACAATTCTCCGCTCACCAAGTACTGCACCAACGT
GACCGAACAGGCGCGCAATCAAGAACTGGATCCGGTGCTGTGTCGTGAGAACGAACTCAACCTGATGATC
GATATTTTGTGCCGCCGCCGCAAAAACAACCCGATTGTGGTCGGGGATGCGGGTGTCGGTAAAAGTGCCA
TGATTGAAGGTTTGGCGCTGCGTGTGGTCGCAGGCACCGTGCCGACACAGCTCCAAAACGTTGAGCTGCT
CTCACTGGATCTCGGTTTGCTGCAAGCGGGTGCTTCGGTGAAAGGGGAGTTTGAGAAACGCTTGAAAGGC
GTGATCGATGCGATTAAGAGCTCGCCAAAGCCGGTCATTCTGTTTATCGATGAAGCGCACACCTTGATTG
GCTCCGGAAATCAGGAAGGCGGCAGTGACGCGGCAAACTTGCTGAAACCCGCTCTGGCGCGTGGCGAGCT
GAGCACCGTCGCGGCGACGACGTGGAAAGAGTACAAAAAATACTTTGAAAAAGATCCGGCACTGACGCGC
CGTTTCCAACTGGTGAAGTTAGAAGAACCGACGATTCCCCAAGCGGTCGACATTTTGCGCGGCCTCAACA
GTGTGTATGAAAAAGCGCACAACGTGCTGATCACCGATGATGCGTTAAAAGCAGCGGCAGAATTATCCGC
GCGCTACATCTCAGGTCGTCAGCTGCCAGATAAAGCGATTGATGTGCTGGACACCGCTTGTGCCCGTATC
GCCATCAACATGACCACGCCGCCCAAACGTCTGGCGCTGCTCGAAACTGCGTGTCACCAACGTCAGTTGG
AAATTGACATGCTGGAGCGCGCGCAATACCTCGGTCGAGACGTTGATCATGCTCGTCTGGATGAACTGCG
CACTCAGGAACTGGCAGACGAAGCGGAAAAAGCCGCGCTGACCGCAAGCTGGCAGCAACAAAAAGAATTG
ATTGAGTCGATCATCAGTCTGCGAGCGGAACTCATGGCCATGTCGACGGCAGATGATGTGGAAGAGGATG
CTCGCGCGGCACTGCAAGCTGAACTCAACACGCAATATCAAACGCTGGCGGCGATTGCGCACCATGAGCG
TTTGATGCACCCCCAAGTCGATGCAGAGCAAATCGCTGAAGTGATTGCCGACTGGACGGGCGTTCCGGTT
GATCAAATGAACACCGATGAACTGCATAAAATTACCCACTTGACCGACATCCTCGGCGCAGCCATCAAAG
GTCAAGATACTGCGATTGAGCGTGTTCATCGCCATTTGTTGACGGCGCGTGCGGATCTGCGCCGTCCGGG
ACGTCCGAAAGGCGCTTTCTTGCTGGTGGGGCCGAGTGGCGTGGGTAAAACTGAAACGGTGGTGCAGCTT
GCCGAACAGCTTTATGGCGGCAAGCAATTCCTCACCACCATCAATATGTCGGAGTACCAAGAGAAGCATA
CAGTTTCTCGCTTGATCGGGTCACCGCCAGGCTATGTGGGCTACGGCGAAGGGGGCATCCTGACCGAAGC
GATTCGCAAAATGCCGTATTCCGTCGTGCTGCTGGACGAAGTGGAAAAAGCCCACCCTGAAGTACTGAAC
ATCTTTTACCAAGCGTTTGATAAAGGTGAGCTGGCTGATGGCGAAGGACGCTTAATCGACTGCCAAAATA
TTGTGTTCTTCCTCACCTCGAATCTTGGTTATCAAACCATCGTGGACTTCGCGGACGATCCCAAAGCTCT
GGATGAAGCGCTGTACCCCGAATTGGCCGCATTTTTTAAACCTGCGCTGTTGGCGCGTATGGAAGTGATT
CCATATATGCCACTCAACAAAGCGATTCTGGAGCTGATCGTCAAAGGCAAACTGGCACGTCTGGAGAAAC
TGTTCCGCGATCGCTACAACGCTGAGGTGGTGATTGAAGATCGCCTGATTGAAGAGATCTTAAATCGCGC
CACGCGCAGCGAAAACGGTGCTCGCATGCTTGAAGCCATCATTGAAGGTCAACTGTTGCCGCCTGTGTCG
CTGGCGCTGTTGAATAAACTGGCAGAGAAGCAACCCGTGCATCGCATTCATTTGGATGCGCTGGACGGTG
AATTTAAAGGAGAGGTGGCGTAA