SecReT6
Protein ID: 375133288
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01188
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1247073..1248473 [+]
Producthypothetical protein
NoteTssA
UniProt IDF0LZM7
KEGG IDvfu:vfu_B01188
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-16, Aligned region: 49..109
Protein Sequence: 466 a.a.     [Download]
>gi|375133288|ref|YP_005049696.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MELTEYRRCVAQPIAGDNPVGERLIDDPLFEFIEDQMMKVGSLSHGSVQWDEVEHSALKLLQGKTKDIKL
LVYLLQCLHNQLSPSRFILSFELMSDFMASFWEASYPAPGKRGNLPRRKFFSQIAQRFSMATEKIDFNQF
DAQDRQALNEAVVAWQSVIEAQGLSSDVVEAVARSVQSELNKVEARQQAEQQQTAKPVESPRPTTTSSVL
SVDNSSDKAAKQTLLKVADFLAEQEFGIALSIRLRRYAVWGTITTLPDHKADGETMLRGMQQDRMKDYQD
QMRHADLTLWRKVEQSLTLSPYWFDGQLMSFTIAQHLGKESWCLAITEETQQFLARMPSLLELKFKGGEP
FVSDSVKEWLASANGSTGGQSVGGDWQEKRKEAMALAKEGGIAVALSMLNDGLVAATEPRDKFYWRMLSA
DLLNANHLDAMAKAQYQTLHHQVTTMQVTDWEPSLVEQLERYTTSE
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1247073-1248473 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGGAATTAACGGAATACCGCCGCTGTGTGGCACAGCCGATTGCCGGAGACAATCCGGTCGGCGAGCGTT
TGATTGACGATCCTCTGTTTGAGTTTATCGAAGATCAAATGATGAAAGTTGGCTCGCTATCGCACGGCAG
CGTGCAGTGGGACGAAGTGGAACACAGTGCGCTGAAATTGCTGCAAGGCAAAACCAAAGACATCAAGCTG
CTAGTGTATCTGCTGCAATGCCTGCACAACCAACTGTCGCCTTCCCGCTTTATTCTCTCCTTTGAGTTGA
TGAGCGACTTTATGGCGTCTTTCTGGGAAGCGAGTTATCCCGCGCCGGGTAAACGCGGCAACCTGCCAAG
ACGCAAGTTTTTCAGTCAGATTGCACAGCGATTTTCGATGGCAACTGAAAAAATCGATTTTAATCAGTTT
GATGCGCAGGATCGCCAAGCATTGAATGAGGCAGTGGTTGCATGGCAAAGCGTCATTGAGGCGCAGGGGC
TGAGTTCGGATGTGGTCGAAGCGGTGGCTCGCTCGGTTCAGAGTGAACTCAATAAAGTCGAAGCGCGTCA
GCAAGCCGAGCAGCAGCAAACGGCCAAGCCTGTTGAGTCGCCGCGCCCGACCACGACCAGTTCAGTCTTG
TCGGTAGATAACTCCAGTGACAAAGCGGCCAAGCAGACGCTGCTCAAAGTCGCGGATTTTCTTGCTGAGC
AGGAGTTTGGCATTGCGCTGTCGATTCGCCTGCGCCGCTACGCCGTGTGGGGGACGATTACCACGTTGCC
GGATCACAAAGCCGATGGTGAAACCATGCTGCGCGGCATGCAGCAAGACCGAATGAAAGATTATCAGGAT
CAGATGCGTCATGCGGATCTGACGCTTTGGCGTAAGGTCGAGCAGAGCCTCACGCTCTCCCCGTACTGGT
TTGACGGCCAACTGATGAGCTTCACCATTGCACAACACTTGGGTAAAGAGAGCTGGTGCCTAGCCATCAC
AGAAGAAACGCAGCAATTTCTCGCCCGGATGCCTTCGCTGCTGGAACTCAAATTTAAGGGGGGCGAACCG
TTTGTCTCCGACAGCGTGAAGGAATGGCTGGCATCCGCCAACGGCTCGACTGGCGGGCAAAGTGTGGGCG
GTGATTGGCAGGAAAAACGCAAAGAAGCGATGGCTTTGGCAAAAGAAGGCGGCATCGCGGTCGCCTTGTC
GATGCTCAATGACGGCCTGGTGGCAGCCACGGAGCCGCGCGACAAATTTTACTGGCGGATGCTTTCTGCC
GATCTGCTCAACGCCAATCATCTCGATGCGATGGCGAAAGCGCAGTATCAAACCTTACATCATCAAGTCA
CTACCATGCAGGTTACCGATTGGGAACCATCGTTGGTGGAACAATTAGAACGATATACAACGTCAGAGTA
A