SecReT6
Protein ID: 375133290
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01190
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1252090..1253367 [+]
Producthypothetical protein
NoteTssA
UniProt IDF0LZM9
KEGG IDvfu:vfu_B01190
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.20E-08, Aligned region: 46..96
Cytochrom_B562 [PF07361], Evalue: 0.001, Aligned region: 120..125
Cytochrom_B562 [PF07361], Evalue: 0.001, Aligned region: 171..184
Cytochrom_B562 [PF07361], Evalue: 0.001, Aligned region: 287..318
Cytochrom_B562 [PF07361], Evalue: 0.001, Aligned region: 333..401
Protein Sequence: 425 a.a.     [Download]
>gi|375133290|ref|YP_005049698.1| hypothetical protein [Vibrio furnissii NCTC 11218]
MSNILFIDNAYYRLTNDTDAIRQLDVYQKIRDEINRRFNPLAGGTDWEVVRESCDALAKRAGLDLLMCGY
FAVANLKTVGLAGYANGLELLSVSLSNQSQPDVKTAKMRKEVLDWVNARVVQELKDLKPNYESLRDLYRC
ERFCERIHHQLERQQPEYLVDFEGVGFALFEHIDRIETQYHSLVKRQHQQAGDAEPQVQRRVHRMRLSLA
FVTGCVLSVGAVWAYQVIPWFHTSDYAMRVEVATLSSDDARRHFQQSVSDNQIARWKSNLVPLYEQSIGQ
KSAISMEQSKREAMHEMATLRTLYPDDEQIKTSDEAFSAAQRAALEQTELFVQRFGEIRTKMANISLLAK
REKWRDLQRQTKSLEDFAVSLSPVYGRVDYVQNLIKQGELESARKELEILKTRLNNLSWTMAQLEESLSG
QPIAQ
 
Nucleotide Sequence: 1278 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1252090-1253367 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGTCCAACATTTTATTTATTGATAACGCTTACTATCGTTTGACCAATGACACCGATGCCATTCGTCAAC
TGGATGTTTACCAGAAAATCAGAGATGAGATTAACCGTCGATTTAATCCGTTAGCGGGGGGAACCGATTG
GGAAGTCGTGCGCGAATCTTGTGACGCGTTGGCAAAGCGTGCCGGGCTGGACCTGTTGATGTGCGGTTAC
TTTGCGGTCGCCAATCTAAAAACGGTGGGATTAGCGGGGTATGCCAACGGGTTGGAATTACTGAGTGTCA
GTTTGAGCAATCAAAGTCAGCCGGATGTGAAAACCGCCAAGATGCGTAAAGAAGTCTTGGATTGGGTCAA
CGCCCGAGTGGTGCAGGAGCTCAAAGACCTGAAGCCCAACTACGAATCGCTACGCGATTTATATCGTTGC
GAACGTTTTTGCGAACGTATCCACCATCAGCTTGAGCGGCAGCAACCGGAGTATTTGGTGGATTTCGAAG
GCGTCGGGTTTGCGCTCTTTGAACACATCGACCGCATTGAAACCCAATATCACAGCCTAGTGAAACGGCA
ACACCAACAGGCGGGGGACGCAGAGCCACAAGTGCAGAGGCGAGTGCATCGCATGCGATTGTCGCTGGCC
TTTGTGACGGGTTGTGTTTTGTCTGTGGGCGCGGTGTGGGCATATCAGGTGATTCCGTGGTTTCACACCA
GCGATTACGCCATGCGTGTTGAGGTCGCGACGCTCAGCAGTGACGATGCGCGCCGCCATTTTCAACAGTC
TGTGTCTGACAATCAAATTGCACGTTGGAAAAGCAATCTGGTGCCACTTTATGAGCAATCAATCGGGCAA
AAAAGCGCTATTTCGATGGAACAGAGCAAACGCGAAGCGATGCATGAAATGGCAACACTACGCACACTCT
ATCCAGATGATGAGCAAATTAAAACAAGCGATGAAGCGTTTAGTGCAGCGCAGCGAGCTGCACTGGAGCA
AACAGAACTGTTTGTGCAGCGATTTGGTGAAATTCGTACCAAGATGGCCAATATTTCGCTGTTGGCCAAG
CGCGAAAAATGGCGTGATTTACAGCGCCAGACCAAATCGTTGGAAGATTTTGCTGTGAGTTTGTCGCCGG
TCTATGGCCGGGTCGATTATGTGCAGAATCTGATTAAGCAAGGCGAACTCGAATCGGCGCGCAAAGAGTT
GGAGATTCTGAAAACTCGTCTCAATAATTTGAGCTGGACGATGGCTCAACTGGAAGAGTCGTTGAGTGGG
CAGCCAATCGCGCAATAG