SecReT6
Protein ID: 375133291
SecReT6 ID530
T6SS typei1
Gene symbol-
Locus tagvfu_B01191
StrainVibrio furnissii NCTC 11218
Repliconchromosome II [GenBank: NC_016628] [Browse all T6SS(s) in this replicon]
Location [Strand]1253554..1256775 [+]
ProductVgrG protein
NoteTssI
UniProt IDF0LZN0
KEGG IDvfu:vfu_B01191
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-65, Aligned region: 45..339
Phage_base_V [PF04717], Evalue: 3.60E-23, Aligned region: 379..472
PG_binding_1 [PF01471], Evalue: 2.10E-08, Aligned region: 754..795
PG_binding_1 [PF01471], Evalue: 2.10E-08, Aligned region: 809..819
DUF2345 [PF10106], Evalue: 0.0031, Aligned region: 577..623
DUF2345 [PF10106], Evalue: 0.0031, Aligned region: 637..680
Protein Sequence: 1073 a.a.     [Download]
>gi|375133291|ref|YP_005049699.1| VgrG protein [Vibrio furnissii NCTC 11218]
MATLKYQFHVEGLEDDTLVVCEFEGQETLSSERMNGQLLNEQPCHGFRYELALASRHANLTPEMVVDKVA
ELTLYRDDVLVQRVNGIVRCFTQGDTGHHHTFYSLTLVPALERLSLRHNSRIFQLKTVPEILSILLQEMS
INDYAFALTRDCAQREFCVQYRETDLDFLHRLAAEEGLVYSFIHEEGKHTLIFSDASDSLPKLGEPIPYN
TLAGGMIESPYISALSVHTQSEVSQTALQDYSFKKPTYSFAQQAVGTEMDYQQPDYEHFDAPGRYKDDVS
GKAFSQIRLDYLRRNAHTATGKSNQPLLRPGVKFDLQEHLDDTLNRDWLVVRVTCQGTQPQALEEAGGNG
ATTYANQFSLIPAHRTWRATPQVKPQVDGPMIATVVGPEGEEIFCDEHGRVKLHFPWDRYSNGDEHSSCW
VRVSQGWAGSQYGMIAIPRIGHEVIVSFLNGDPDQPIVTGRTYHATNTAPYTLPDNKTKTVLRTETHQGQ
GYNELSFEDQAGSEQIYLHAQKDFDGLIENDHTSVIKHDKHLTVENDRFTQIKNNQHLTLGGESRTKIVA
DRSVEIAGASQNKVAKLIAVQAGREISLKGGTKIVVEAGAEVTLKAGGSFVKVDAGGVHLSGSAINLNAG
GSAGSGSGYGGKSALFAKNLVSLESPAELQQAAIQSTQVAGEANVVTVSELVAPVLGEGAQQQSASSQAA
SGSAVNSTQAEPQAENDVESTKEPRLKSDVLKPSETLNQLADREVASYKTGSKGQEVELIQNALIKLGFD
LGTYGADGSFGNTTERQVKMFQQSYTPSHSTHPDYKVGKVDGIVGQGTLLGLDEALVDGWVCDLITKGML
DTVCPGSGNDQSLLAALNKYCPLYEINTPVRISHFLAQVAHESGCFSSLVEGSNYQHMAAKIKFSKYRAY
VNSLKPGSVNRFLREDNPSRCKQPDLFNFVYSDSNGNGDESSGDGYKYRGRGLIQITGKGKYEKFTTTHN
AKSTDDLRDFSTMPELVSDNIDYAVESACMYWRNWGALSKKFNANGDINVLIDNAPDDIKLVSQAVNGGT
YGSSNGLEDRMNKFDKLKIYFGL
 
Nucleotide Sequence: 3222 bp     [Download]
>gi|375132168|ref|NC_016628.1|:1253554-1256775 Vibrio furnissii NCTC 11218 chromosome 2, complete sequence
ATGGCGACGTTAAAGTATCAGTTTCATGTGGAAGGTCTGGAGGACGACACGCTGGTGGTGTGTGAGTTCG
AGGGGCAGGAGACGCTTTCTAGCGAACGCATGAATGGGCAGTTATTGAATGAACAACCGTGCCACGGGTT
TCGTTATGAATTGGCGCTCGCCAGTCGGCATGCCAACCTAACGCCCGAGATGGTGGTAGATAAAGTCGCG
GAGCTGACGCTCTATCGCGATGATGTGCTGGTTCAACGCGTAAACGGCATCGTGCGCTGCTTTACGCAGG
GCGATACCGGCCATCACCATACCTTTTATTCACTCACGTTAGTCCCTGCTTTAGAGCGTTTGTCTCTGCG
CCATAACAGCCGCATCTTCCAACTTAAAACTGTGCCGGAAATCCTCTCTATCCTGCTGCAGGAAATGAGT
ATCAACGATTACGCCTTTGCGCTGACTCGCGACTGCGCGCAGCGTGAATTCTGCGTTCAGTACCGCGAAA
CTGATTTAGATTTTCTCCATCGCTTAGCGGCCGAAGAAGGGTTGGTGTACAGCTTCATTCATGAAGAAGG
CAAGCATACACTGATATTCAGCGACGCCTCAGACAGCCTGCCGAAACTCGGTGAGCCAATTCCGTACAAC
ACGCTGGCAGGCGGCATGATTGAATCACCGTACATCTCAGCGTTGAGCGTGCACACCCAATCTGAGGTGA
GCCAAACGGCGTTGCAGGATTACAGTTTCAAAAAGCCGACATACTCCTTTGCCCAGCAAGCGGTCGGGAC
CGAAATGGACTACCAGCAGCCAGACTACGAACATTTCGATGCGCCGGGGCGGTATAAAGACGATGTCAGC
GGCAAAGCGTTCAGCCAGATCCGCCTTGATTACCTGCGCCGCAACGCGCACACCGCAACGGGCAAAAGTA
ATCAACCGCTGCTGCGTCCGGGGGTAAAGTTTGACTTGCAAGAGCACCTCGACGACACCTTAAACCGAGA
TTGGCTGGTGGTGCGTGTCACCTGCCAAGGCACGCAGCCTCAGGCGCTAGAAGAAGCGGGCGGCAATGGC
GCGACCACCTACGCGAACCAATTCTCGCTCATCCCGGCGCATCGCACCTGGCGTGCCACGCCGCAAGTCA
AACCTCAGGTTGATGGCCCGATGATCGCCACAGTCGTTGGGCCAGAAGGTGAAGAGATTTTCTGTGATGA
ACACGGCCGCGTAAAACTGCATTTCCCTTGGGATCGCTATTCCAATGGTGATGAGCATAGCTCCTGCTGG
GTGCGTGTCTCGCAAGGGTGGGCGGGCAGCCAATACGGCATGATTGCCATTCCGCGCATTGGTCATGAAG
TGATTGTGTCGTTTCTCAATGGCGACCCCGACCAACCAATTGTCACCGGTCGTACCTATCACGCCACCAA
CACTGCGCCGTATACGTTGCCAGACAACAAAACCAAAACTGTGCTGCGCACCGAAACCCATCAAGGGCAG
GGCTATAACGAACTCAGTTTTGAAGACCAAGCGGGCAGCGAACAAATTTACCTGCACGCGCAGAAAGACT
TTGATGGCCTGATTGAAAACGACCACACCAGCGTCATAAAGCACGACAAACACCTCACGGTGGAGAACGA
TCGCTTTACTCAGATCAAAAACAATCAACATCTGACGTTGGGCGGCGAAAGCCGCACTAAAATCGTAGCT
GACCGTAGTGTTGAGATTGCTGGCGCTTCACAAAACAAAGTCGCGAAGCTGATTGCGGTGCAAGCTGGGC
GTGAAATTTCACTGAAAGGTGGCACCAAAATTGTGGTCGAAGCTGGTGCAGAGGTCACCTTAAAGGCTGG
AGGAAGTTTTGTGAAGGTCGACGCCGGTGGCGTCCACCTTTCAGGATCTGCGATTAACCTCAATGCCGGG
GGAAGTGCAGGCAGTGGGAGTGGTTATGGCGGCAAGTCCGCCCTGTTTGCCAAGAATCTTGTCAGTTTGG
AATCGCCAGCAGAATTGCAACAGGCGGCGATTCAATCCACCCAAGTTGCTGGTGAGGCAAATGTCGTGAC
CGTGTCTGAACTGGTGGCTCCCGTCTTAGGCGAGGGCGCTCAACAGCAGAGCGCATCATCTCAGGCAGCA
TCGGGTTCAGCGGTAAATTCAACGCAAGCCGAGCCGCAAGCGGAGAACGACGTTGAATCCACGAAAGAAC
CTCGACTGAAATCTGATGTGTTGAAACCTTCCGAAACGCTCAATCAATTGGCAGACCGTGAAGTTGCTTC
CTACAAAACGGGTTCAAAAGGTCAAGAAGTTGAATTGATTCAGAACGCACTGATAAAACTGGGGTTTGAT
CTCGGTACCTACGGCGCAGATGGTAGTTTTGGCAATACAACGGAGCGCCAAGTCAAAATGTTTCAGCAAA
GCTATACGCCGTCCCATTCGACACATCCTGACTATAAAGTCGGCAAGGTTGATGGCATTGTGGGGCAAGG
AACCTTGCTGGGCTTGGATGAAGCATTGGTTGATGGGTGGGTTTGTGACCTGATTACTAAAGGTATGTTG
GACACTGTTTGTCCAGGTTCGGGAAACGATCAGAGCTTATTGGCAGCATTAAATAAATATTGTCCATTGT
ACGAGATCAATACGCCTGTTCGAATTAGCCACTTTCTTGCTCAGGTGGCCCATGAAAGTGGTTGCTTTAG
TAGTCTTGTTGAAGGCAGCAACTATCAACATATGGCAGCAAAAATCAAATTTTCAAAGTATAGAGCTTAC
GTAAATTCATTGAAACCTGGATCAGTAAATCGATTTTTACGAGAAGACAATCCGTCAAGATGCAAGCAAC
CAGATCTGTTTAACTTTGTCTATTCAGATAGCAATGGGAATGGTGATGAAAGCTCAGGGGATGGGTACAA
ATATCGAGGTAGAGGGCTGATTCAGATTACAGGTAAAGGAAAGTATGAAAAGTTCACGACTACGCACAAC
GCTAAAAGTACAGATGATCTTCGAGATTTTTCAACGATGCCAGAGTTAGTGTCGGATAATATTGATTATG
CTGTAGAATCTGCATGTATGTATTGGCGAAATTGGGGTGCTTTATCTAAGAAGTTTAATGCGAATGGAGA
CATCAATGTTCTGATAGATAATGCTCCGGATGATATAAAGTTGGTAAGCCAAGCGGTAAATGGTGGAACT
TACGGAAGTTCTAATGGATTAGAGGACCGTATGAACAAGTTTGATAAATTAAAAATTTATTTTGGATTGT
GA