SecReT6
Protein ID: 375134243
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000625
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]653847..656966 [+]
Producthypothetical protein
NoteTssI
UniProt IDF0KJN2
KEGG IDacc:BDGL_000625
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-54, Aligned region: 46..385
Phage_GPD [PF05954], Evalue: 5.40E-54, Aligned region: 650..722
DUF2345 [PF10106], Evalue: 5.00E-47, Aligned region: 708..859
T6SS_Vgr [PF13296], Evalue: 5.20E-39, Aligned region: 577..685
T6SS_Vgr [PF13296], Evalue: 5.20E-39, Aligned region: 740..767
Phage_base_V [PF04717], Evalue: 1.30E-17, Aligned region: 445..557
Protein Sequence: 1039 a.a.     [Download]
>gi|375134243|ref|YP_004994893.1| hypothetical protein BDGL_000625 [Acinetobacter calcoaceticus PHEA-2]
MMSHKIFQILDSLGLVAQNRVLHVQFSNASLNSQVFLQRIEGEHTLNQGSVAELLCLSTNAHIALKQFIG
CQVAVDQVTDMGQLFRTTGIITEASQGQSDGSLTIYNLTLKDPTALWHKRRNSRVFMNKSVRDISEILFK
EWQGKSPLFAASLTLDTSGLTKDYDVRPFVMQSNESDYDFLTRLWRSEGINWLVDESQLFVVDPNASIQP
QVLRLIDDNQNYQALERRSLRYQRSSATEQYDTVTQVKAERRLQPTSVHVQRWQADVLQQEEGSGSVQGT
QKHSEHYDNASLNLEDAWLVSPAWMQDLKGEDQATASGNSQIEQLNQHINAYHHLSSKQFTVSGNVRDAQ
VGYWFALNDHPELDQHDSADKEFLISSKHYYNQNNLPKELQQQLERLLPKDKLKAAQIDSQNPEQRHFAE
LNVVRRNIKAVPEYNPLEHRPAAHPQRARVVGLDGESIHVDQWGRIKVRFLNVDQWGRIKVRFLFTRTDD
HSHDGGAGSNDNDTDSAWVDVLTPWAGAGYGARFLPRVGEIVVIDFFDGNVDRPFVVGRIHEAERHPTQF
DQKGQLPDTKKLSGIRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAASQLNLGNLSHPKDKAESDGRGEG
FELRTDQWGAVRAGSGLLVSTHKQDQAQGVHLDANEAKQQIEGGLNNAKALSEVAKNQQTDPLEMLENLK
TFIEQIEEKDQDKAAAFKQALMILTATNSIALASNEDIHLSADGQLSQTAGDSINLSTQKNLIAHAQNKI
SLFAAQEGARLYAGKGKVEIQAQGDGADLIARKAVQVISTEDKIEISASKEIVITAGGSQIKINGSGIFP
VTGGKFEVKAGQHLFMGSGSASSNLPALPQLNMSPKELELKYVYDDLKPVAQAPYKLIFQDGSIQEGLLD
GNGYAKVQVPVDKIQPKVYYGFSNMEAKPDQLKQHNSFKDKKVMSIVAAEQLIEQYNKQELDYLLDEYFP
DEIQAMIDGQGVEYDDHINDYVEKDLEQQNNPDDAIADHAEEIPLNEQAATHVGLGEDL
 
Nucleotide Sequence: 3120 bp     [Download]
>gi|375133618|ref|NC_016603.1|:653847-656966 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGATGTCCCATAAAATATTTCAAATTTTAGATAGTTTAGGGTTGGTCGCACAGAACCGCGTTCTTCATG
TGCAATTTTCCAACGCATCATTAAACAGTCAAGTTTTCTTGCAACGCATTGAGGGCGAACATACGCTCAA
CCAAGGTAGCGTTGCTGAGTTACTGTGTCTATCGACCAACGCACATATTGCATTAAAACAATTTATTGGC
TGTCAGGTTGCCGTCGATCAAGTCACTGACATGGGGCAGCTTTTTAGAACAACAGGTATTATTACCGAAG
CAAGCCAAGGGCAAAGTGATGGCTCACTCACCATTTATAATCTCACCTTAAAAGACCCGACTGCACTCTG
GCATAAACGCCGTAATAGTCGCGTATTTATGAACAAAAGCGTGCGCGATATTAGCGAAATTCTGTTTAAA
GAATGGCAGGGTAAAAGCCCGTTATTTGCCGCAAGCTTAACACTCGACACATCTGGCTTAACCAAAGACT
ACGATGTGCGTCCATTTGTGATGCAGTCTAACGAAAGCGATTATGACTTTTTAACCCGTTTGTGGCGTAG
TGAAGGCATTAACTGGCTGGTCGATGAATCGCAACTTTTTGTCGTTGACCCGAATGCTTCCATTCAGCCA
CAAGTTTTACGTTTAATTGACGATAACCAAAACTATCAGGCACTTGAACGTCGTAGCCTGCGCTACCAAC
GCAGCAGTGCGACAGAACAGTATGATACCGTTACTCAAGTCAAGGCAGAGCGCCGCTTACAACCAACCTC
TGTTCATGTGCAACGCTGGCAAGCCGATGTCCTACAACAAGAAGAAGGCAGTGGCAGCGTACAAGGCACC
CAAAAGCACAGTGAACACTATGACAATGCGAGCCTAAACCTTGAAGATGCATGGCTTGTCAGCCCCGCTT
GGATGCAAGACTTAAAAGGGGAAGACCAAGCTACAGCTTCAGGCAACAGCCAGATTGAACAGTTAAACCA
GCACATTAATGCTTACCATCACCTGAGTTCTAAACAGTTTACCGTTTCAGGTAATGTTCGTGATGCACAG
GTCGGTTATTGGTTTGCACTCAATGATCACCCAGAACTTGATCAACATGATAGTGCCGACAAAGAGTTCT
TAATCTCAAGCAAACACTACTACAATCAGAATAATTTACCGAAAGAATTACAACAGCAACTTGAGCGTCT
GTTGCCAAAAGACAAGCTCAAGGCAGCTCAAATCGATAGCCAAAACCCAGAGCAACGCCATTTTGCTGAG
CTGAATGTTGTTCGACGCAACATTAAAGCTGTGCCTGAATATAACCCGCTAGAGCACCGACCAGCCGCTC
ATCCGCAGCGCGCTAGAGTGGTGGGGCTGGACGGCGAAAGCATTCATGTCGACCAGTGGGGACGCATTAA
AGTCCGCTTCCTGAATGTCGACCAGTGGGGACGCATTAAAGTCCGCTTCCTGTTTACCCGAACTGACGAC
CATAGTCATGATGGTGGAGCAGGAAGTAACGACAATGACACTGACTCCGCTTGGGTTGATGTGCTCACCC
CATGGGCGGGTGCAGGTTATGGAGCACGCTTCCTGCCACGTGTCGGCGAGATCGTGGTCATCGACTTCTT
TGACGGCAATGTTGACCGCCCATTTGTGGTGGGACGCATCCACGAAGCCGAACGCCACCCAACCCAGTTT
GATCAGAAAGGCCAATTACCTGATACTAAAAAACTTAGCGGCATCCGCTCAGAAGAAGTCGACGGTAAAG
GCTTTAACCAGCTACGTTTTGATGACACCACAGGCCAGATCAGTGCTCAGCTACAGAGTAGCCATGCGGC
AAGCCAATTAAACCTCGGTAACTTAAGCCATCCTAAAGACAAGGCGGAAAGTGATGGCCGAGGTGAAGGT
TTTGAACTCAGAACAGACCAATGGGGTGCGGTTCGAGCTGGCAGTGGCTTACTCGTTAGTACCCACAAGC
AGGATCAAGCTCAAGGTGTACACCTCGATGCAAATGAGGCCAAACAACAAATAGAAGGCGGTCTGAATAA
TGCTAAGGCACTCAGTGAAGTTGCTAAAAATCAGCAAACTGACCCATTGGAAATGCTTGAGAACCTAAAA
ACGTTCATAGAGCAAATTGAAGAAAAAGATCAAGACAAAGCTGCTGCTTTTAAGCAAGCTTTGATGATAT
TAACGGCAACTAACAGTATCGCTTTAGCTAGTAACGAGGACATTCACCTCAGCGCAGATGGTCAGTTAAG
TCAAACTGCTGGTGATAGCATTAACCTGTCTACTCAAAAAAACCTGATTGCACATGCACAAAATAAAATT
AGCCTTTTTGCAGCTCAAGAAGGTGCAAGACTTTATGCAGGCAAAGGTAAAGTCGAGATACAAGCACAAG
GTGACGGAGCAGATTTAATTGCCCGTAAAGCTGTTCAGGTGATTTCAACAGAAGACAAAATTGAAATTAG
TGCTTCTAAAGAAATCGTTATTACGGCGGGTGGATCTCAAATCAAGATTAATGGCTCGGGAATTTTTCCA
GTTACGGGTGGTAAGTTTGAGGTAAAGGCTGGGCAGCATTTGTTTATGGGAAGTGGCAGTGCTTCGAGTA
ATTTACCTGCTTTGCCTCAGTTGAATATGTCGCCTAAAGAGCTTGAACTTAAGTACGTGTATGACGATTT
AAAGCCAGTCGCTCAAGCACCTTATAAACTTATATTTCAGGATGGCTCAATACAAGAAGGACTTCTGGAT
GGTAATGGTTATGCAAAAGTCCAAGTCCCTGTTGATAAAATCCAGCCAAAGGTTTATTACGGTTTTAGCA
ATATGGAGGCTAAACCTGATCAGCTCAAACAGCATAATAGCTTTAAAGATAAAAAAGTGATGAGTATTGT
GGCAGCAGAACAATTGATCGAACAATATAACAAGCAAGAACTTGACTACTTATTAGATGAATATTTCCCT
GATGAAATACAAGCCATGATAGATGGGCAGGGTGTTGAGTATGATGATCATATCAATGATTATGTAGAAA
AAGATTTAGAACAGCAAAATAATCCAGATGATGCTATTGCTGATCATGCAGAAGAAATCCCATTGAATGA
ACAAGCGGCTACACATGTGGGTCTTGGGGAGGATTTATGA