SecReT6
Protein ID: 375134257
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000639
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]672832..673335 [+]
Producthypothetical protein
NoteTssB
UniProt IDF0KJP6
KEGG IDacc:BDGL_000639
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.90E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|375134257|ref|YP_004994907.1| hypothetical protein BDGL_000639 [Acinetobacter calcoaceticus PHEA-2]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKIAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|375133618|ref|NC_016603.1|:672832-673335 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGGCTAAGAGAGAGAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCAAAAGAAGCGAAAGAACTACCATTCGTTGTGGGTGTGATGGGTGATTTTTC
GGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTTGATTTAGATAATATT
GATGAAGTTATGGAGTCATTGTCTCCAAGAGCTGCTTTCCAAGTAGATAATACATTGACAGAAGAGGGTG
GTAAGATCGCTGTTGATTTAACATTTAAGTCAATGGAAGATTTTCGTCCAGAAAACGTGGTTCAACAGGT
TGATCCATTAAAGAAACTTGTGGAAGCTCGTGAGCGTTTAACTGACTTAAGAAACAAAATTTCTAATAGT
GAACGTTTAGAAGACTTACTTGATGAAGTTCTTAAAAATACAGATCAGATTCGTAAATTAAGTGCGGAGG
CTGATCATGAATAA