SecReT6
Protein ID: 375134258
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000640
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]673328..674809 [+]
Producthypothetical protein
NoteTssC
UniProt IDF0KJP7
KEGG IDacc:BDGL_000640
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.70E-192, Aligned region: 65..489
Protein Sequence: 493 a.a.     [Download]
>gi|375134258|ref|YP_004994908.1| hypothetical protein BDGL_000640 [Acinetobacter calcoaceticus PHEA-2]
MNNTQSAAIPLVENEQVNLLDSIVEESRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIA
EIDALISSQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLF
KKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTDIDRPR
DVSKIFETAEYVQWRSFRDSEDARYVALTLPHVLGRLPYHPKEGTATEGFNFAEDVSGANHNEYLWMNAA
YAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQ
SSN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|375133618|ref|NC_016603.1|:673328-674809 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGAATAATACTCAATCCGCAGCAATACCTCTTGTTGAAAATGAACAGGTTAATCTCTTAGACTCGATTG
TTGAAGAAAGCCGTATTGCCCGAAATGAAGAAGAACATTCACGTGCAAAAAGCTTAATCGGTGAGCTTGC
TAAAGAAGTAATGGCAGGAACAATTACTGTTTCTGAAAATATGACTTTATCAATTGATAAGCGTATTGCA
GAAATTGATGCGCTGATTTCAAGTCAATTAAGTCAGATCATGCACAATGAACAATTCCAAAAAATTGAGT
CAACTTGGCGTGGTCTCTATTATTTCTGTCAAGAGACACCATCTAACCCTCTTATTAAAATTCGTATGTT
AAATACGACTAAGAAAGAGTTGGTAAAAGATTTCCAAGGCGCTACAGACTTCGATCAAAGCACCTTATTC
AAAAAAATCTATGAGGAAGAATACGGATCTTTTGGTGGTGCACCATATTCAGCGCTCATTGGTGATTTTG
AATTTGACCGTACGCCTTCTGACATGTATTTGCTTGAGCAAATCTCTCATGTTGCTGCAGCAGCACATGC
GCCATTTATTTCGGCCGCTAGCCCAAGCATTCTTGGTCTAGAGTCATTTACTGATATTGACCGTCCTAGA
GATGTTTCAAAAATCTTTGAAACAGCTGAATATGTTCAATGGCGTTCATTCCGTGACAGTGAAGATGCTC
GTTATGTCGCTTTAACCTTGCCGCATGTGCTTGGTCGTCTTCCTTACCATCCAAAGGAAGGAACAGCTAC
AGAAGGGTTTAACTTTGCTGAAGATGTTTCGGGTGCAAACCACAACGAATATTTGTGGATGAATGCTGCT
TATGCTTTCGGTACTCGTTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCAATTCGTGGTGTTG
AAGGCGGTGGTTTAGTCGAAGGCTTACCTGTTCATACGTTTAAAACACAAGATGGCGAAGTTGTATTCAA
ATGCCCAACAGAAATTGCGATTACTGATCGCCGCGAAAAAGAATTAAGCGATCTGGGCTTTATTCCTTTA
GTGCATTGTAAAAATACCGATTACGCTGCTTTCTTTGGCGCGCAATCAACTCAAAAACCTAAAAAATATG
ACAATGATACAGCAAATGCTAACTCTGCTTTATCAAGTCAAATTCAGTACATCATGGCCGTTTCACGTAT
TGCTCATTATTTAAAAGCAATGATGAGAGACAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCA
TTCTTAAATGAGTGGTTGTCACAGTATGTATTACTTGATGATGGCGCTTCTCAAGAAGCAAAAGCTCAAT
ACCCTCTACGTGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGT
TTTCTTGCGACCACACTTCCAGCTGGACGAGTTGTCAGTTTCTTTACGACTTGTCACTGAGTTACCTCAG
TCCTCAAATTAA