SecReT6
Protein ID: 375134260
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000642
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]675441..675917 [+]
Producthypothetical protein
NoteTssE
UniProt IDF0KJP9
KEGG IDacc:BDGL_000642
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|375134260|ref|YP_004994910.1| hypothetical protein BDGL_000642 [Acinetobacter calcoaceticus PHEA-2]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVVDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|375133618|ref|NC_016603.1|:675441-675917 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGAATTTAGATCGGCTTTATCCATATGGATTTCGTTCAACTTTGTTTGACCGCTTAATTCCTGAAAGTG
AAGATTATGCAAAAGGTCTTTCTATTCAGCAATTAAGAGAATCGGTAGCAAAAGATTTAGAAGACTTACT
TAACAGTCGAGTCGCTAAATTGGATCATGTAGTTGATGATTACCCGCTAGTTAAAAAATCTATACTTCAG
TTCGGTATTATTGATTTTGTGGGGCTTTCTACAGCCAATCCGCTAGATCGTGACAAGATTTGCCAATCTA
TTGAACAGTCAATTGCAGCTCATGAACCTCGGTTAAGACAAATACGGGTAGAGATGTTGTTGGATGGGCA
CAATATGGGGGCATTGTGTTTAAGCATTCAGGCGTATCTAAATATTCATCCACTGTATGAACCTGTCGTT
TTTGATGCATTGTTAAAACCGACAACGCAGCAATATGTAATTTCAGCGAGAACCTAG