SecReT6
Protein ID: 375134261
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000643
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]675932..677743 [+]
Producthypothetical protein
NoteTssF
UniProt IDF0KJQ0
KEGG IDacc:BDGL_000643
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-153, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|375134261|ref|YP_004994911.1| hypothetical protein BDGL_000643 [Acinetobacter calcoaceticus PHEA-2]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLISARIDKKLADSYDV
FTRSLFEVMFPQYLRHFPACSVISFEDINKIKQLTEAHIVPAHTVLKSRSFKGVQCEFNTTQEVKLLPIN
LQALEFKSTPSAHMHLSQNATLTFKFEIFNHAHVCLINEKLPIYLDAISNFPLQVLDSIFKKGTTFAIKI
GQKIVELDKNPFELTGFSEQESLLPLDQHTHHAYRLLMEYFCFPEKFNYLKLDLGFLKRLSLEDNNFELL
IHFKLNLNDQAVVRNYSELNVANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLITDAHHPEFYQVYSITE
MNMVREKTSQEESYVPVLPFFAMSHYHADTARFFYAVNYQKLQPNFVEMGYSIISKNLNPSSTRSDFIST
KLLCSNRDLPHEALGQSNNILNLNDSSLARRAIVLKRPTKPYQFGQSQSEQWRVISHLSLNSLALMKGDA
VSHIKELLALYNLPLSKENYLIIESIKHLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVIKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|375133618|ref|NC_016603.1|:675932-677743 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
GTGATAGAAGAGCTTTTACCTTTTTACGAAAAACAACTACAGGAATTTGGTCAGCAATCTCGTGAATTTG
CTCAAAAATATCCGAAAATTGCTCAACGTTTATCTTTAAATCAAGAGCAGATTGATGACCCGCATATCGA
ACGTCTTATACAGGCATTTTCATTAATTTCTGCTCGTATTGATAAGAAACTAGCTGATAGTTATGACGTC
TTTACACGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGTCATTTTCCGGCTTGTTCAGTAATCA
GTTTTGAAGATATAAATAAAATAAAACAGCTCACAGAAGCGCATATTGTTCCTGCTCACACAGTTTTGAA
GTCACGTAGCTTTAAAGGGGTTCAGTGTGAGTTTAATACTACGCAAGAAGTCAAATTACTCCCTATAAAT
TTACAAGCGCTAGAGTTTAAAAGCACACCTAGTGCACACATGCATTTAAGCCAAAATGCGACTTTAACTT
TTAAGTTTGAAATTTTTAATCATGCTCATGTATGTTTAATAAATGAAAAACTACCTATTTATTTAGATGC
AATTTCTAATTTTCCACTTCAAGTACTAGACAGTATTTTTAAGAAGGGAACAACTTTTGCCATTAAAATA
GGGCAGAAAATTGTTGAACTGGATAAAAATCCATTTGAGTTAACAGGTTTTTCCGAGCAAGAAAGTCTAT
TGCCACTCGATCAGCATACTCATCATGCTTATCGTTTACTGATGGAGTATTTTTGTTTTCCTGAAAAATT
TAATTATCTAAAACTCGATTTAGGTTTTTTAAAGCGCTTATCTCTAGAAGATAATAATTTTGAACTGCTT
ATACATTTTAAATTAAATTTAAATGATCAAGCTGTAGTGCGAAATTATTCTGAATTAAATGTCGCTAATT
TTAAATTGTTTACTACACCAGTTATTAATTTATTTGAAAAATACGCTGAACCACAAAAAATTGTACATAA
GCAATTAGAATATCCGCTGATTACAGATGCTCATCATCCTGAGTTTTATCAGGTGTATTCAATTACTGAA
ATGAATATGGTTCGTGAAAAAACGAGTCAAGAAGAAAGCTATGTTCCGGTGCTGCCTTTTTTTGCCATGA
GTCATTATCATGCTGACACAGCACGTTTTTTCTATGCAGTGAATTATCAAAAGCTGCAGCCCAATTTTGT
CGAAATGGGTTATTCAATTATTTCTAAAAATTTAAATCCTTCGTCAACACGTTCGGATTTTATTAGCACA
AAACTATTATGCTCAAATCGTGACTTACCGCATGAAGCATTAGGGCAATCTAATAATATATTAAACCTTA
ATGATAGTAGTCTGGCTCGCCGCGCTATTGTTTTAAAAAGACCTACAAAACCTTATCAATTTGGTCAAAG
CCAGAGTGAGCAGTGGCGTGTTATTTCACACCTTTCATTAAATAGTTTAGCTTTAATGAAAGGTGATGCG
GTATCTCATATTAAAGAGTTACTTGCTTTATATAACTTACCTTTATCAAAAGAAAATTATCTAATTATTG
AATCAATCAAACATCTGGAATTTTCACTTACTCACAAACTTGTAGATGGAAAGCCATTTCCAATGTTTGT
AAGAGGAGTAAAGGCAGAGTTACAAATTGATTCATCCGTATTTAGAGGTCATAGCCTATACATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTTATTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA