SecReT6
Protein ID: 375134262
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000644
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]677707..678705 [+]
Producthypothetical protein
NoteTssG
UniProt IDF0KJQ1
KEGG IDacc:BDGL_000644
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.20E-62, Aligned region: 19..311
Protein Sequence: 332 a.a.     [Download]
>gi|375134262|ref|YP_004994912.1| hypothetical protein BDGL_000644 [Acinetobacter calcoaceticus PHEA-2]
MQSERWWQDSSVTAELFTKPKSFEFIQATRLLRHDSSRTVSSSWSDHFKFETSFNLNFPATEIENLELTD
ERIYITNLIVGLTGIQGALPYTYTNKIKQAPRQQRVETKEFLSLFNHKLTAQYVDSSITYNLPIRYEIEH
KNDYLDILHALNGYVRSQHQQADLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
SDQLTTLGGSQPSLLGVNTFCGETIQQIDGKIEIQIGPLKRQQYLSFLPNQELSLKLKKLVETWCSPTLS
IDLRLILDESEIQPICLTYKNQSGLGQGSFLISRQPKVHSHETCYSLIGETI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|375133618|ref|NC_016603.1|:677707-678705 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACAGCTGAGCTCTTTACAAAGCCAAAGTCTTTTG
AGTTTATCCAAGCAACACGGCTATTAAGGCACGATTCAAGTCGTACAGTTAGTTCATCTTGGAGTGATCA
TTTTAAGTTTGAGACATCCTTTAATTTAAATTTTCCTGCTACAGAGATAGAAAATTTAGAATTAACGGAC
GAGCGGATTTATATTACGAATTTAATTGTTGGTCTTACTGGTATACAAGGTGCTTTACCTTATACGTATA
CGAATAAGATTAAGCAAGCTCCACGTCAGCAACGCGTTGAGACTAAAGAGTTTCTAAGCTTATTTAATCA
TAAGCTTACTGCTCAATATGTAGATTCTAGTATTACTTATAATCTACCGATTAGATATGAGATAGAACAT
AAAAATGACTATTTAGATATTCTGCATGCTTTGAATGGTTATGTGCGTTCGCAGCATCAACAAGCTGATC
TTGATGAATATTTCGCAGAATTTTCAGGATTAATGCAGGGGCAAAATAATACAGTTCATGCATTAAAAAC
GATGCTGTCCTGTATTTTTAAACATGAAATTACGATTAAAGAATTTGTACAAGAATCCTTTAAGTTAGCG
AGTGATCAGTTAACAACTTTAGGTGGAAGTCAGCCGAGTCTACTTGGTGTTAATACTTTTTGTGGGGAAA
CCATTCAGCAGATTGACGGAAAAATTGAAATTCAAATTGGACCTTTAAAACGTCAGCAATATCTCAGTTT
CTTACCAAATCAAGAGTTAAGCTTAAAGCTTAAGAAACTTGTAGAAACGTGGTGTAGTCCAACTTTATCA
ATAGATTTAAGGCTTATCTTGGATGAATCAGAAATACAACCTATTTGTCTCACTTATAAGAATCAGAGTG
GGTTAGGCCAGGGTTCTTTTCTCATATCACGACAACCAAAAGTACATAGTCATGAAACCTGCTATAGCCT
TATTGGAGAGACAATATGA