SecReT6
Protein ID: 375134265
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000647
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]680503..683370 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0KJQ4
KEGG IDacc:BDGL_000647
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.60E-71, Aligned region: 63..325
IcmF-related [PF06761], Evalue: 1.30E-54, Aligned region: 337..361
IcmF-related [PF06761], Evalue: 1.30E-54, Aligned region: 371..712
DUF1215 [PF06744], Evalue: 2.20E-22, Aligned region: 649..672
DUF1215 [PF06744], Evalue: 2.20E-22, Aligned region: 735..765
DUF1215 [PF06744], Evalue: 2.20E-22, Aligned region: 844..949
Protein Sequence: 955 a.a.     [Download]
>gi|375134265|ref|YP_004994915.1| hypothetical protein BDGL_000647 [Acinetobacter calcoaceticus PHEA-2]
MSFLGIPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWL
GFLNILKKNRSKAPVNGLILIVSIAELISQSPENSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIA
GFTEFFEFYEAQEYNQAWGATLPYEQNSSHNAVDLFEKHYTILYDGLKGVSSTHLSRRHSQNISPSVMTF
PLEFKTLKPALKSFIGTLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLTQIAQNDLKDHS
KITPNHGYFLNGLFSDVILKDKDLVKQHVNTGRKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIGEVQ
ADLNKVVQLERASGQQLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQI
VLTPTQQNIAQYLQRVKNNETTLKANHTNVEIKQTAQSQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDA
SHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLANDKQFPVLEADSQIVDQTRQVLLSVVRG
MPARDRVYNEIKMRAAVRFPALTVSQIVGETNKNIVLGSYALPGVFTQKAWNDYVEKAIEEAADKPTDSK
DWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKAGQFAQQVKNIDVLGEPQNSPI
RTLIERVAVETNWDNPVVQAELAAPQKGFIAWFKRKVLNHDDKQVANQVANNAQGAISQEYQMFYQLVRK
RDDQQGKSLLDEYMTNLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFNEI
DQRLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGEN
GSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNPQSSQWYGNW
 
Nucleotide Sequence: 2868 bp     [Download]
>gi|375133618|ref|NC_016603.1|:680503-683370 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGAGCTTCCTTGGTATCCCAGCCGCAGGTAAAAGTTCAGCTATCTATAACTCTGGTTTAAAGTTTCCTT
TTGAAGAAACACATCAGAAAATGGTATCAGCTGGCTTAAGTGGTACTCGAAATTGTGACTGGTTCTTCTC
TACAGAAGGTATTTTGCTCGATACAGCGGGCCGTTATTCTGTTTATAGCGAAGATCATTCTGAGTGGTTA
GGTTTCTTAAATATTTTAAAAAAGAACCGCTCTAAAGCACCAGTTAATGGTTTGATTCTAATTGTTAGTA
TCGCTGAGTTAATTAGTCAAAGTCCTGAAAACTCATTAAAGCTTGCTAAAAATTTACGTGCTCGTATTCA
AGATCTAACTGAACGTTTAGAAGTGGTAGTACCTGTTTATTTAGTCTTTTCAAAGATGGATTTGATTGCA
GGTTTTACCGAGTTTTTTGAATTTTATGAAGCTCAAGAATATAACCAAGCTTGGGGGGCAACGCTTCCAT
ATGAGCAAAATTCTTCTCATAACGCGGTAGATTTGTTCGAAAAACATTACACCATTCTTTACGATGGTCT
AAAAGGGGTAAGTTCGACTCATTTAAGTCGCCGTCATTCGCAAAATATCTCACCAAGTGTAATGACTTTC
CCATTAGAGTTTAAAACATTAAAACCAGCTTTAAAGAGCTTTATTGGTACACTTTTTGAAGATAACCCAT
ATCAATTTCAACCTGTTTTCCGTGGGTTTTACTTCACTAGTGCTTTGCAGGAAGGTGTAATTGAAAGTCC
AATGACTGAACAAATTGCACAAGAATTCCAACTTACACAAATTGCTCAAAATGATTTAAAAGACCATTCA
AAAATTACTCCTAACCATGGCTATTTCTTAAATGGTCTATTCTCAGATGTTATTTTAAAAGATAAAGATC
TCGTTAAGCAGCATGTAAATACGGGCAGAAAACGTCAACGTTACATTGCATTTATTGGTGCTTTAGCGGG
TGTTTCAATTATTTTGGGTGTATGGGTTTGGTCTTATCGTAATAACCAGCAATTAATTGGTGAAGTTCAA
GCAGATTTAAATAAAGTCGTTCAATTAGAAAGAGCCTCTGGTCAGCAACTATCTACTCAATTAGAAGCTT
TATTGATTCTTCAAAGACGTTTACAGCAGTTAGATGAGTTTGATGAAAATAGACCACTTAAGTTTAGTTT
TGGTTTATATCAGGGCAATGAGCTTCGTGAAAAGCTAAAAGCTGAATATTTAAAAGGTGTTAAGCAGATT
GTGTTAACACCAACACAGCAAAATATTGCTCAATATTTGCAACGTGTAAAAAATAATGAAACAACATTAA
AAGCGAACCACACGAATGTTGAGATCAAGCAAACTGCTCAATCTCAACAATATTTGGAACCTTCAGATAC
CAATCCTCAAGATGCTTATAATGCATTAAAAGCGTATTTGATGATGAGCAATCCGCAATATATGGATGCT
AGTCATCTAAGCGATCAGGTTACGCGTTTCTGGCGTTCTTGGTTAGATGCAAATAAAGGCCAAATGCCAC
GTGCAGATATGATTCAAGAAGCTGAACAGATCTTGTCGTATGCAATGACCTTAGCAAATGATAAACAATT
CCCAGTTTTAGAAGCAGATTCGCAAATTGTTGATCAAACTCGTCAAGTATTGCTCTCTGTTGTTCGAGGG
ATGCCAGCGCGTGATCGTGTTTATAACGAAATAAAAATGCGTGCTGCGGTGCGTTTCCCAGCACTGACTG
TAAGTCAGATTGTGGGGGAGACAAATAAAAATATTGTATTGGGTAGTTATGCATTACCAGGCGTATTTAC
CCAAAAAGCTTGGAATGACTATGTAGAAAAAGCAATTGAGGAAGCTGCAGATAAGCCAACAGACAGTAAA
GACTGGGTGTTAAATAGTCGACAATCTGATGATTTAACTTTCTCGGGTAGTCCAGAACAAATTAGAAAGC
AGCTAACAGCGCTTTATAAGCAAGAATACATTGCTGAATGGAGAAAATTCTTAAGTGGTATTCATTATGC
TAAAGCTGGCCAATTTGCTCAGCAAGTAAAAAATATTGATGTTTTAGGTGAGCCGCAAAACTCTCCAATT
AGAACATTAATTGAAAGAGTTGCAGTCGAAACAAACTGGGATAATCCGGTTGTTCAAGCTGAGCTTGCAG
CTCCACAAAAAGGATTTATTGCATGGTTTAAACGTAAAGTTTTAAATCATGATGATAAGCAAGTTGCTAA
TCAAGTGGCAAACAATGCCCAAGGCGCTATTTCTCAAGAATACCAAATGTTCTACCAGTTGGTTCGCAAA
CGTGATGATCAACAAGGTAAGTCATTACTTGATGAATATATGACAAATTTAGCACTCGTTCGTAGTAAGT
TTAATGAGCTTAAAAATGCGGGCGAAATTGGGCCTAATGCAATGACATTAGTCAAACAGACCCTAAATGA
GCAAACGTCTGTATTTAACCAAACTCAAAAAATTGTAGATGAAAAGATGGCGGTTGGTTTCAATGAAATT
GATCAGCGTTTACTGCAAAAATTAGTAGTTAGCCCACTTACGCAAGCTTTTGAGAGTTTAATTACACCGA
CACAAGACGAAATTAATAAATTATGGGTAATGCAAGCCTATCAACCATTTACAGCAAATCTTGCTAAGAA
ATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGAAATTGGTCAAATCTTGGGTGAGAAC
GGTAGTATTTCTCGCTTTGTAAAAGAAAGTCTTGATCCATTTGTGATTCGTCGTGGCTATACGTTAACGT
CTAAAACTTGGAAAGATTTAGGCATTAGTTTAAATCCTCAATCCAGCCAATGGTATGGCAACTGGTGA

Protein ID: 375134264
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000646
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]680214..680534 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0KJQ3, F0KJQ3
KEGG IDacc:BDGL_000646
PDB IDNA
Domain hit(s) vs Pfam DUF4381 [PF14316], Evalue: 0.0018, Aligned region: 10..76
MSC [PF09402], Evalue: 0.0065, Aligned region: 8..79
Protein Sequence: 106 a.a.     [Download]
>gi|375134264|ref|YP_004994914.1| hypothetical protein BDGL_000646 [Acinetobacter calcoaceticus PHEA-2]
MALMSSYTSIPRHIFWALATAYVLGLIVYGIYWLIQRRKHAAQGEELAEAIEKDNQAEYGKNKDKEELQL
VSQQMKESIQLIRKSKLGDKKGNAALYELPWYPSRR
 
Nucleotide Sequence: 321 bp     [Download]
>gi|375133618|ref|NC_016603.1|:680214-680534 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
GTGGCATTGATGTCTTCATATACTTCAATTCCTCGTCATATATTCTGGGCTTTAGCAACTGCCTATGTTT
TGGGTCTTATTGTTTATGGTATCTATTGGCTTATTCAACGAAGAAAGCATGCTGCTCAAGGTGAAGAGTT
AGCTGAGGCAATCGAAAAAGATAACCAAGCTGAATATGGCAAAAATAAAGATAAAGAAGAGCTTCAGCTA
GTTAGTCAACAAATGAAAGAATCAATTCAACTGATTCGTAAATCTAAGTTGGGTGATAAAAAAGGGAATG
CTGCATTATATGAGCTTCCTTGGTATCCCAGCCGCAGGTAA

Protein ID: 375134266
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000648
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]683357..683920 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0KK59, F0KK59
KEGG IDacc:BDGL_000648
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 187 a.a.     [Download]
>gi|375134266|ref|YP_004994916.1| hypothetical protein BDGL_000648, partial [Acinetobacter calcoaceticus PHEA-2]
MATGELNAQAQAAPATNQSNFQFYPIPNPQLLSYTVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITA
VDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYA
GMQLVDKVTADKAARVVSAQQAPAQAAPARTENPVSALAQSSAGVKP
 
Nucleotide Sequence: 564 bp     [Download]
>gi|375133618|ref|NC_016603.1|:683357-683920 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGGCAACTGGTGAGTTGAATGCTCAAGCGCAAGCTGCTCCAGCGACTAACCAATCTAACTTCCAGTTCT
ACCCAATTCCAAACCCACAATTGCTTTCATATACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAA
TGGTGTTCAGCAATGGGTTAACTTCATTTGGCCAAACCAAGGCAGTATTCCAGGTGCTCGTATTACCGCT
GTAGATTTACAAGGCCAAACCCACACGATTTTTGATGAGCCAGGTGAGTACGGTATTAACCGTTTAATTG
ATAGTGCTCAACGTAAAGAACAAAATGGCGGATTTGAAATGCTTTGGCGTAGTAAAACTGATCCATCATT
ATTTGTAAAAATGAATTTCCGTCTAATTAGCAGTAATTCAGGCAGTATTGGTTCAAGCCGTGGTTATGCA
GGTATGCAACTGGTTGATAAAGTCACTGCCGACAAAGCAGCTCGTGTGGTGTCTGCTCAGCAAGCGCCAG
CTCAAGCTGCTCCAGCAAGAACTGAAAATCCTGTTTCAGCACTTGCTCAGTCTTCTGCGGGAGTTAAACC
ATGA