SecReT6
Protein ID: 375134268
SecReT6 ID520
T6SS typei4b
Gene symbolmotB
Locus tagBDGL_000650
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]684920..685687 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDF0KK61, F0KK61
KEGG IDacc:BDGL_000650
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.50E-24, Aligned region: 25..41
OmpA [PF00691], Evalue: 2.50E-24, Aligned region: 154..248
BON [PF04972], Evalue: 0.0011, Aligned region: 31..66
Protein Sequence: 255 a.a.     [Download]
>gi|375134268|ref|YP_004994918.1| OmpA/MotB domain-containing protein [Acinetobacter calcoaceticus PHEA-2]
MNQRYQTKLSQLIQGCFIYAIANYALAQPIVVEGVVPNEASKQAILLKMQSVYGADQVVDKIQVRPVAAP
NGWSDSVTRVITPDLKKVSQGKLSVNGTRFELSGKMLNPADIQPTIQSFQGLVQPPYQLYSQLSVNQAEQ
KIIDDALKNRIIEFESGSAVLTDAGQKILDEMAIALNKVGGKKVKIVGHTDSSGDATKNLKLSQDRALAV
KNYLISKSIPADHLSTEGLGSSKPVADNTSPEGRKKNRRIEFTVL
 
Nucleotide Sequence: 768 bp     [Download]
>gi|375133618|ref|NC_016603.1|:684920-685687 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGAATCAACGATATCAAACTAAACTTTCACAGCTCATACAAGGCTGTTTTATCTATGCAATCGCTAACT
ATGCTTTAGCTCAGCCGATTGTTGTAGAAGGAGTCGTTCCTAACGAGGCAAGTAAACAGGCCATCTTATT
AAAAATGCAATCTGTTTATGGTGCTGATCAGGTTGTAGATAAAATACAAGTAAGACCCGTAGCTGCTCCA
AATGGATGGAGTGATTCCGTGACTCGAGTGATTACGCCTGATCTTAAAAAGGTTTCACAAGGCAAATTAA
GCGTAAACGGTACTCGGTTTGAGTTGAGTGGAAAAATGCTAAATCCAGCAGATATCCAGCCTACAATTCA
ATCTTTTCAAGGATTAGTGCAGCCACCGTACCAACTGTATTCACAGTTATCAGTCAATCAGGCTGAGCAG
AAAATTATTGATGATGCACTTAAAAATCGAATTATTGAGTTTGAATCTGGTAGCGCAGTTTTAACTGATG
CGGGTCAAAAAATTCTTGACGAGATGGCTATTGCTTTAAATAAAGTTGGCGGCAAGAAAGTCAAAATCGT
AGGACATACAGATAGTTCTGGTGATGCGACTAAAAACTTAAAACTTAGTCAAGACCGAGCATTGGCAGTT
AAAAACTATTTGATTAGTAAGAGTATTCCTGCCGACCATTTATCTACAGAAGGTTTAGGTTCATCTAAGC
CAGTTGCAGATAACACTTCTCCAGAAGGAAGAAAGAAAAACCGTCGGATTGAGTTTACTGTTCTATAA