SecReT6
Protein ID: 375134270
SecReT6 ID520
T6SS typei4b
Gene symbolclpV1
Locus tagBDGL_000652
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]686116..688797 [+]
ProductClpA/B type protease
NoteTssH
UniProt IDF0KK63
KEGG IDacc:BDGL_000652
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-43, Aligned region: 229..307
AAA_2 [PF07724], Evalue: 1.00E-43, Aligned region: 606..774
AAA [PF00004], Evalue: 1.20E-22, Aligned region: 230..343
AAA [PF00004], Evalue: 1.20E-22, Aligned region: 611..734
AAA [PF00004], Evalue: 1.20E-22, Aligned region: 849..864
AAA_5 [PF07728], Evalue: 7.20E-14, Aligned region: 230..251
AAA_5 [PF07728], Evalue: 7.20E-14, Aligned region: 610..728
ClpB_D2-small [PF10431], Evalue: 9.10E-13, Aligned region: 384..397
ClpB_D2-small [PF10431], Evalue: 9.10E-13, Aligned region: 780..851
AAA_16 [PF13191], Evalue: 9.30E-12, Aligned region: 17..58
AAA_16 [PF13191], Evalue: 9.30E-12, Aligned region: 207..252
AAA_16 [PF13191], Evalue: 9.30E-12, Aligned region: 274..309
AAA_16 [PF13191], Evalue: 9.30E-12, Aligned region: 472..504
AAA_16 [PF13191], Evalue: 9.30E-12, Aligned region: 605..654
AAA_16 [PF13191], Evalue: 9.30E-12, Aligned region: 676..704
AAA_16 [PF13191], Evalue: 9.30E-12, Aligned region: 776..827
AAA_22 [PF13401], Evalue: 7.50E-10, Aligned region: 229..323
AAA_22 [PF13401], Evalue: 7.50E-10, Aligned region: 607..637
AAA_14 [PF13173], Evalue: 1.40E-07, Aligned region: 230..333
AAA_14 [PF13173], Evalue: 1.40E-07, Aligned region: 608..693
AAA_14 [PF13173], Evalue: 1.40E-07, Aligned region: 851..878
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 227..246
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 607..714
AAA_25 [PF13481], Evalue: 7.40E-07, Aligned region: 230..292
AAA_25 [PF13481], Evalue: 7.40E-07, Aligned region: 285..326
AAA_25 [PF13481], Evalue: 7.40E-07, Aligned region: 606..637
AAA_25 [PF13481], Evalue: 7.40E-07, Aligned region: 837..865
AAA_19 [PF13245], Evalue: 7.60E-07, Aligned region: 230..250
AAA_19 [PF13245], Evalue: 7.60E-07, Aligned region: 606..632
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 230..316
NACHT [PF05729], Evalue: 4.10E-06, Aligned region: 610..637
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 230..278
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 466..495
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 609..647
IstB_IS21 [PF01695], Evalue: 8.90E-06, Aligned region: 224..290
IstB_IS21 [PF01695], Evalue: 8.90E-06, Aligned region: 610..630
Zeta_toxin [PF06414], Evalue: 2.90E-05, Aligned region: 230..251
Zeta_toxin [PF06414], Evalue: 2.90E-05, Aligned region: 605..650
AAA_18 [PF13238], Evalue: 5.70E-05, Aligned region: 53..128
AAA_18 [PF13238], Evalue: 5.70E-05, Aligned region: 230..260
AAA_18 [PF13238], Evalue: 5.70E-05, Aligned region: 472..544
AAA_18 [PF13238], Evalue: 5.70E-05, Aligned region: 611..640
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 62..102
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 209..243
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 282..379
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 478..528
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 606..656
RuvB_N [PF05496], Evalue: 0.00017, Aligned region: 229..248
RuvB_N [PF05496], Evalue: 0.00017, Aligned region: 300..310
RuvB_N [PF05496], Evalue: 0.00017, Aligned region: 574..632
RuvB_N [PF05496], Evalue: 0.00017, Aligned region: 679..704
RNA_helicase [PF00910], Evalue: 0.00072, Aligned region: 231..254
RNA_helicase [PF00910], Evalue: 0.00072, Aligned region: 611..632
AAA_29 [PF13555], Evalue: 0.00088, Aligned region: 222..246
AAA_29 [PF13555], Evalue: 0.00088, Aligned region: 605..621
AAA_29 [PF13555], Evalue: 0.00088, Aligned region: 714..737
DUF258 [PF03193], Evalue: 0.0018, Aligned region: 226..250
DUF258 [PF03193], Evalue: 0.0018, Aligned region: 589..635
DUF2075 [PF09848], Evalue: 0.0041, Aligned region: 230..332
DUF2075 [PF09848], Evalue: 0.0041, Aligned region: 384..469
DUF2075 [PF09848], Evalue: 0.0041, Aligned region: 609..641
T2SE [PF00437], Evalue: 0.0041, Aligned region: 205..249
T2SE [PF00437], Evalue: 0.0041, Aligned region: 373..459
T2SE [PF00437], Evalue: 0.0041, Aligned region: 582..679
MobB [PF03205], Evalue: 0.0056, Aligned region: 231..264
MobB [PF03205], Evalue: 0.0056, Aligned region: 609..640
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 231..301
AAA_33 [PF13671], Evalue: 0.007, Aligned region: 609..632
Protein Sequence: 893 a.a.     [Download]
>gi|375134270|ref|YP_004994920.1| ClpA/B type protease [Acinetobacter calcoaceticus PHEA-2]
MMSNLKILITKLSTVARTALEKSANACVIQQNYEIEIEHLFLELLNQSLENDLKILLKKYKISSEALADD
LKETISQLPKGNTRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLL
PIDSMKHKFLEICEKSVEQQDETKTPPDEVESTEATVANTKVAKTPALDQYTINLTEKAKKGCIDPVIGR
EYEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPNALKNVHLHVLDMGLLQAGASVKG
EFENRLKQVIQEVQASTHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYF
EKDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQQHFKLQIDDEAIVTAVHSSHRYISGRQLPDKAISV
LDTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLEALKANLESLQKEIHETEEQ
WQKELELVHKIQELEAQNHANESEAFDQINLLRKDLADIQGQQPLVFERVNSQIINEIISDWTGIPVGKM
VNDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKAKLEDPNKPQGVFLLVGPSGVGKTETALTLANE
LYGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFY
QVFDKGTLEDGEGRVIDFKNTTILLTSNAGSSAIMQACLNRPVEEWPTAEELIEHLKPSLYKQFKPAFLG
RMRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTQVQYSEDLVELLLSRCTEVDSGARNVDNILNSTV
LPALATEILVALAEQKLPKIIMIDAKDDEIQYVLDPVVKAAKKRTSKKLKSEV
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|375133618|ref|NC_016603.1|:686116-688797 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGATGAGTAATTTAAAAATTTTAATTACAAAACTTTCTACAGTTGCACGAACTGCATTAGAAAAATCGG
CTAATGCTTGTGTTATTCAACAAAATTACGAAATTGAAATTGAGCATCTATTTTTAGAATTACTTAATCA
ATCTTTAGAGAATGATTTAAAAATTTTATTAAAGAAATATAAAATTTCATCTGAAGCTTTAGCTGATGAT
TTAAAAGAAACAATTTCTCAATTACCAAAAGGTAATACCCGAACTCCTATTTTTGCTAAATCTATTGTTC
GTTTGTTTGAACAAGCTTGGTTATTAGCTTCGGCTGAACAAAATCCCGTTATTCGTAGTGGTCATTTATT
AGTTGCGTTATTAACCGCACCTGATTTATATCAAATTGCAACAAGAGCTTCGAGTTTATTTGACCTTTTA
CCGATTGATTCAATGAAACACAAGTTTCTTGAAATTTGTGAGAAGAGTGTTGAACAACAAGATGAAACAA
AAACACCACCTGATGAGGTGGAGTCAACAGAGGCGACTGTAGCAAATACCAAAGTAGCTAAAACACCTGC
ACTTGATCAATATACGATTAATCTCACTGAAAAAGCGAAAAAAGGCTGTATAGATCCAGTTATTGGCCGT
GAATATGAAATTCGCTTAATGCTCGATATTTTAATGCGTAGACGCCAAAACAATCCGATCTTAACCGGAG
AGCCAGGTGTTGGTAAAACAGCTGTAGTGGAAGGTTTGGCTTTAAAAATTGCTCAAGGTTTAGTACCAAA
CGCCCTTAAAAATGTTCATTTGCATGTGTTAGATATGGGGCTTTTACAGGCAGGTGCAAGTGTTAAAGGC
GAGTTTGAAAATCGTTTAAAACAGGTTATTCAAGAAGTTCAAGCTTCTACTCATCCTATTATTTTATTTA
TTGATGAAGCGCATACTTTAATTGGTGCAGGTGGACAAGCAGGGCAAAACGATGCTGCAAATCTTTTAAA
GCCAGCGCTTGCACGTGGTGAATTACGCACGATTGCTGCGACTACTTGGGCAGAATATAAACAGTATTTT
GAAAAAGATGCGGCATTGAGCCGACGTTTTCAGGTAGTAAAAGTAGAAGAGCCAACTGAAGAAGTTGCAG
TAGATATGTTGCGAGCGATGATTCCAGTCATGCAGCAGCATTTTAAATTGCAAATTGATGATGAGGCGAT
CGTTACTGCGGTTCATTCTTCACATCGATATATTAGTGGTCGCCAACTTCCCGATAAAGCAATTAGTGTG
CTTGATACGGCTGCAGCACGTGTTGCTTTGACTCAAAATGCTCAACCTGTAAAGCTTGATCAATTAAAGG
CCCAAGAGCATAACTTAAAGCTTGAACAGCAAATTTTAGAAAATGAACATCGTCAGATTCCAATTCATCA
TGAACGCTTGGAAGCTTTAAAAGCTAATTTAGAATCTCTGCAAAAAGAGATCCATGAAACCGAAGAGCAG
TGGCAAAAAGAATTAGAACTTGTTCATAAAATTCAAGAGTTAGAAGCACAGAATCATGCTAATGAGTCTG
AAGCTTTCGATCAGATTAATCTGCTGCGTAAAGATCTTGCCGATATTCAAGGCCAGCAACCATTAGTATT
TGAAAGAGTAAACTCTCAAATTATTAATGAAATTATTTCTGACTGGACTGGTATTCCTGTTGGAAAAATG
GTCAATGATGAAATTAAACAGATATTAACGCTTGAAGATAAATTGGGCGAGCGTGTAATGGGGCAAGATT
ATGCACTCACACAATTAGTTCAAGGGATTAAAACTTCAAAAGCAAAACTTGAAGATCCCAATAAGCCACA
AGGTGTATTTCTTTTGGTCGGACCAAGTGGTGTAGGTAAAACTGAAACTGCATTAACTTTGGCAAATGAG
TTATATGGTGGTGAGCAGCACTTAATCACAATTAATATGTCTGAATATCAAGAAGCCCATACTGTATCTT
CGTTGAAAGGTGCACCTCCAGGATATGTCGGATATGGTCAAGGTGGAGTTTTAACAGAAGCGGTTCGCCG
TAACCCATATAGTGTTGTGTTGCTTGATGAAATTGAAAAAGCTCATAGCGATGTTCAGGAACTGTTCTAT
CAAGTATTCGATAAAGGTACTTTAGAAGATGGTGAAGGACGAGTAATTGATTTTAAAAACACGACTATTT
TGTTAACTTCAAATGCTGGTTCAAGTGCCATTATGCAGGCTTGCTTAAATAGACCTGTAGAAGAGTGGCC
TACAGCTGAAGAGTTAATTGAGCACTTAAAACCAAGTTTATATAAACAATTTAAGCCTGCATTTTTAGGC
CGAATGAGAGTTGTACCTTATTTCCCACTGCATGATGATCTACTTGTACGAATCATTAAGCATAAGTTAG
GCAAAATCACAGCAAGAATTGAGAAACAATACGGTACACAAGTCCAGTATTCTGAAGATTTGGTAGAGCT
CCTCTTAAGCCGTTGTACAGAAGTCGATAGTGGTGCGCGTAACGTTGATAATATTTTAAATTCTACAGTG
TTACCTGCATTGGCTACAGAAATTTTGGTGGCTTTAGCAGAGCAAAAACTACCAAAAATTATCATGATTG
ATGCTAAAGATGACGAAATTCAATATGTACTAGACCCAGTTGTAAAAGCTGCTAAAAAAAGGACTAGTAA
AAAATTGAAGTCAGAAGTTTAA