SecReT6
Protein ID: 375134271
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000653
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]688820..689914 [+]
Producthypothetical protein
NoteTssA
UniProt IDF0KK64
KEGG IDacc:BDGL_000653
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-21, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|375134271|ref|YP_004994921.1| hypothetical protein BDGL_000653 [Acinetobacter calcoaceticus PHEA-2]
MNIDISELLEPISDSLPCGDDFSFSNEFHEIKKAKTQDDLLLDQGDWVAERKQADWDFVAKNTSVLLKDK
TKDIRLLTWLLEAWTHLYGFEGMAKGLTLSHTMLNQYWQEIHPVIEDDDLDQRIGLLQGLINQLPMLLKK
VSLTNTAPYYNLLDYDNFLYHENVRRKQTEEYDSQSGPSELEQFDQAIFNTSKTFQYSNYQDFSSVLTEW
DVLKQTLDHLMGLDSPSFAAIDSAFETIHSTLRKIYKAEAFGTGLAPIQEQATVITSSSMENQVPVQVVS
DQPAFQPQAQTHLANREQAMKVLQDIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|375133618|ref|NC_016603.1|:688820-689914 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGAATATTGATATTTCTGAACTACTCGAACCCATTAGTGATAGTTTACCTTGTGGTGATGACTTTTCGT
TTTCAAATGAATTTCATGAAATAAAAAAAGCGAAAACACAAGATGATCTATTACTAGATCAAGGTGATTG
GGTTGCTGAGCGCAAACAAGCCGATTGGGACTTTGTAGCAAAGAACACAAGTGTTTTGCTAAAAGATAAA
ACGAAAGATATTCGTCTATTAACTTGGCTCTTAGAGGCTTGGACTCATCTTTATGGTTTTGAAGGTATGG
CTAAAGGTTTAACTTTAAGCCATACCATGCTGAATCAATACTGGCAGGAAATTCACCCTGTTATTGAAGA
TGATGACTTAGATCAACGCATTGGTTTATTACAGGGTTTAATTAATCAACTTCCGATGTTGTTAAAGAAA
GTTTCTTTAACCAATACAGCTCCTTATTATAATTTGCTTGATTACGATAATTTTCTATATCACGAAAATG
TTCGCCGTAAACAAACTGAAGAGTATGACAGCCAGTCGGGACCATCTGAATTAGAACAATTCGACCAAGC
CATTTTTAATACTTCTAAAACTTTTCAATACTCTAATTATCAAGATTTTAGTTCAGTTTTAACCGAGTGG
GATGTTTTAAAACAGACTCTTGATCATTTAATGGGATTAGATTCGCCGAGTTTTGCTGCTATTGATTCGG
CATTTGAGACTATTCACAGCACATTGCGTAAGATTTATAAAGCAGAAGCTTTTGGTACTGGGCTTGCGCC
AATCCAAGAACAAGCTACTGTTATCACGAGTTCATCTATGGAAAATCAAGTGCCTGTACAAGTTGTTTCA
GATCAGCCAGCTTTTCAGCCTCAAGCACAAACGCACTTGGCTAACCGTGAACAAGCAATGAAAGTGCTGC
AAGATATTGCCGATTACTTCCAAGCAAATGAACCGCATAGCCCTGTGAGCTATATGCTTCAAAAAACGAT
TAAATGGAGTCAAATGCCATTACATGAATGGTTAGCGCAAGTCATCAAAGATGAGCATCCATTACAAATG
GTTCAGGAAATGTTAGGTGTGCAGCCTAAAAATGAATATGAATAA