SecReT6
Protein ID: 375134272
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000654
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]689931..691295 [+]
Producthypothetical protein
NoteTssK
UniProt IDF0KK65
KEGG IDacc:BDGL_000654
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-124, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|375134272|ref|YP_004994922.1| hypothetical protein BDGL_000654 [Acinetobacter calcoaceticus PHEA-2]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGIQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDDLNLRGEMLIYLALPLLQANKQNLIDQNQAQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDVHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASESLISNLKR
TLNVIKAKIKTIQNNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLNHFVQYPQIHPERLFFELLRLAG
SLLTFSTAYDVDQLPAYKHHNLQESFSQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEVEPH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|375133618|ref|NC_016603.1|:689931-691295 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGCGAAGGTTTATTTTTAAGACCTCAACATTTCCAAATTCAAG
ATACGTATCATGAACAACGCCTAAATCATACGGTTCGCGCAGTTGTGCCTTTTTCGTATGGCATTCAAAA
GTTAAGTTTCGATGAAGCTCAGTTGAGTACGCATATTCTTGCTCTTGAGTCTGTAGAGATGATCTGGCAA
GACGGTGAAATTTATCAGGCACCTGCATATGATCTATTGCCTGAACCAATTTTATTAGACGATCTTAATT
TACGTGGTGAGATGCTAATCTATTTAGCATTGCCGCTTTTACAAGCAAATAAGCAAAATCTAATTGATCA
AAACCAAGCGCAAAAGGGTAGATATCAATCACACCTTGTTGAAACGCATGATTTGTTTACTAATGCTACT
GAAGCAGATATTAGTTTGCTACGCCGCCGTGCTGTTTTTAAATTATTAGATGTACATAGTAATCCAGACC
ACAATCTAGATGGTTTCTTATATCTGCCGATTGGAAAGATTAAGCGTCAAAGCTCCGGCGCTTTTGAAAT
TGATCGAAAGTTTATTCCGCCAATTTTGCACGTGGATGCCTCAGAATCACTCATTTCAAACTTAAAAAGA
ACACTGAATGTGATTAAGGCAAAAATTAAGACGATTCAAAACAATAACCGAGAAAATGAACAGAAGTTAA
TTGAATTCCGTTCAGGTGATATCGTTTCATTCTGGTTAGTAAATGCCTTAAACACAGCTCATGCTGGCCT
GAATCATTTTGTGCAATATCCACAGATCCATCCAGAACGGTTGTTCTTCGAATTGTTACGTTTAGCAGGT
TCTTTATTAACCTTCTCGACGGCTTATGATGTTGATCAGTTGCCTGCCTATAAACACCATAATTTACAAG
AAAGTTTTTCGCAGTTAGACACGATTCTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTGCACTTAAAGAAATCCGCCCTTCATATTGGGTGGGAAGTCTTGAGACCGATAAGATTACTCGAGAT
ACTCGACTTTATATTGCAGTATCAAGTAGTGCAATGCAGACACATGAGTTGATCCAGATCGTACCTTTAC
GATTCAAGATTGGTAGCACTTTAGATGTAGAGCAACGTGTAGTTGCTGCATTACCTGCAATTCCATTGCA
TCACTTGATTCAGGTTCCAACAGCGATCCCAGTACGTTCTGGTGTGAGCTATTTTGAAGTTGAACCCCAT
CATGAATTATACCAACGCATGTTAGATTCAGAGACGATTTGTATTTATGTTCCGGCTGGCTTCCAAGATA
TCAGTATTGAACTGATTGCGGTTATGAACGCTTAA