SecReT6
Protein ID: 375134273
SecReT6 ID520
T6SS typei4b
Gene symbol-
Locus tagBDGL_000655
StrainAcinetobacter calcoaceticus PHEA-2
Repliconchromosome [GenBank: NC_016603] [Browse all T6SS(s) in this replicon]
Location [Strand]691313..692119 [+]
Productaspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
NoteTssL
UniProt IDF0KK66
KEGG IDacc:BDGL_000655
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-53, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|375134273|ref|YP_004994923.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Acinetobacter calcoaceticus PHEA-2]
MSQSTGAPSLFDDGQIGTGGNNNSQSQAKLQAINLIDLLHDGFYLVFLIRNQYVPADAQQFREKILNLLN
QFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNAWLISPLQLSLFGSQLAGYRFFEILE
QLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVSRVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHREVPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHVTIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|375133618|ref|NC_016603.1|:691313-692119 Acinetobacter calcoaceticus PHEA-2 chromosome, complete genome
ATGTCACAATCCACTGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGAACGGGTGGGAACAATAATA
GCCAGTCTCAAGCAAAACTACAGGCAATTAACCTCATTGATTTATTACATGATGGCTTTTATTTGGTGTT
TTTGATTCGAAATCAGTATGTGCCGGCAGATGCTCAGCAGTTTCGTGAAAAAATCTTAAATTTACTCAAT
CAATTTGAGCAACAAGCTAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCATTTT
GTGCTTTGATTGATGAAACTATCGTAACGCAACAAGACCCAAGCTATTTTAATTTGCAAAATGCTTGGTT
AATTAGCCCATTGCAATTGAGCTTGTTTGGTTCTCAGTTAGCTGGGTATCGTTTCTTTGAAATATTGGAA
CAACTGCGAAGTCGTGGAAAAGAACGTCTAGCTGCGTTAGAAGTATTTCATTACTGCCTTTTGCTCGGTT
TTCAAGGTAAGTACCGAATTGAATCTATTGAAAGTCTCAACCACCTAGTATCAAGAGTGGGTGATGAAAT
TGACTATTTAAAAGGGAAAAAAGTTGCGTTTTCGCCGTTCTCGGCAATTCCTGATCAAATACGAAATATT
ATTCATCGCGAAGTACCTTTCTTTTGGATTTTGATCTTTTTATTGATTTTTGCATTACTTACCTTTGCAG
GCTTAAGATTTATGCTCAACAATCAAAATGATAAAGCATTATCTAACTATCAAAATGTGATTTCTGCTCC
TCAAGAGCAAGCACATGTTACAATTTATTTACCTTGA