SecReT6
Protein ID: 375145901
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2598
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3225267..3227084 [-]
ProductRhs element Vgr protein
NoteVgrG
UniProt IDG8TR24
KEGG IDnko:Niako_2598
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 1.20E-17, Aligned region: 365..447
Phage_GPD [PF05954], Evalue: 1.20E-16, Aligned region: 74..336
Protein Sequence: 605 a.a.     [Download]
>gi|375145901|ref|YP_005008342.1| Rhs element Vgr protein [Niastella koreensis GR20-10]
MAQLISSNITIAGTPIKQITSFQLTQNIFDHHYFRLVCPAESLEGLEGGMLQSSRNLIGGVLQASFSTPA
TGSGLQFRGIVMQVEADRFSGHTGNIIISGTSPTIVLDNGPHCKSWEKKAIKNIAQDVLKHFPQDLLQPQ
VSPAYPETLAYTVQYKQTAWQFLNFLCSGYGEWLYYDGNQLQIGAPKASDATALTFGSNISRFSMALQVQ
PANSQMMAYDYLNHDVYTSTPQSIESKAGLNDLGRHVFQASNTVYATQPKVWNNQFVSNKKQLDDSINIR
MAMQSSNTVRFSGSSAHPGVKIGGNISIQGQNLYNMAGESYGEYTVLSISHYFDEQGNYSNDFTAVPSTI
KLPPVKAGAMPHSETQSAMVTDNHDPKGLGRVRVKFHWMNGAEKTPWIRVTSPHGGGGKGMFFIPEVGEE
VIVGFEGDSPIKPYIIGTVYHGKASNAYSNAANDVKALQTRSGNKVIMNDKDGSVFVEDKDGNSMLIDGA
GNITVKSNKTVLIDATNEITLKTKKITMLAEDEIVMQSKVLDAQFTETSTIYGKNENNVLAKTTVTIGSD
NKVDIGGLEVSTYGKTKVALDSEGSVEANGKLMTTIVGGQVKLNC
 
Nucleotide Sequence: 1818 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3227084-3225267 Niastella koreensis GR20-10 chromosome, complete genome
ATGGCCCAACTAATTAGTAGCAATATAACCATTGCCGGTACTCCTATTAAACAAATTACCTCTTTTCAGC
TAACCCAAAATATTTTCGATCATCATTACTTCCGCCTGGTATGTCCCGCAGAATCACTGGAAGGGTTGGA
AGGGGGAATGCTGCAATCGTCACGTAACCTCATTGGAGGCGTTTTACAGGCCTCATTCAGCACCCCTGCA
ACCGGCAGCGGTTTACAATTCAGAGGCATAGTAATGCAGGTAGAGGCCGACAGGTTCAGCGGCCATACCG
GTAACATCATCATCTCCGGAACCAGTCCCACCATTGTGCTCGACAACGGCCCGCACTGCAAAAGCTGGGA
GAAAAAAGCGATCAAGAACATCGCCCAGGACGTGCTGAAGCATTTTCCGCAGGACCTGCTGCAGCCGCAG
GTATCTCCAGCATATCCCGAAACACTGGCCTATACGGTTCAGTACAAACAAACCGCCTGGCAGTTCCTCA
ACTTCCTTTGCTCCGGTTATGGCGAATGGTTGTACTACGATGGCAACCAGTTGCAGATAGGCGCGCCAAA
AGCGTCAGATGCAACTGCACTCACATTCGGAAGCAACATCAGCCGTTTCAGCATGGCGTTACAGGTACAA
CCTGCCAACAGCCAGATGATGGCGTATGATTACCTCAATCACGATGTATATACCAGCACACCACAAAGCA
TTGAAAGCAAAGCAGGCCTTAACGACCTGGGCCGTCACGTATTTCAGGCAAGCAACACGGTATACGCCAC
GCAGCCCAAAGTATGGAACAACCAGTTTGTAAGTAATAAAAAACAGCTGGACGATTCCATTAACATCCGC
ATGGCCATGCAAAGCAGTAATACGGTTCGCTTTTCAGGCAGCAGTGCACACCCGGGCGTTAAAATTGGAG
GTAATATTAGCATACAGGGCCAAAACCTCTACAACATGGCCGGCGAAAGCTATGGCGAATACACCGTTCT
TTCCATCAGCCATTATTTCGATGAACAGGGAAACTATAGCAACGACTTTACAGCAGTTCCTTCCACTATA
AAATTGCCACCGGTGAAAGCAGGGGCCATGCCACATTCAGAAACACAAAGCGCCATGGTAACCGATAACC
ACGATCCCAAAGGCCTGGGCCGGGTTAGGGTTAAATTTCACTGGATGAATGGCGCCGAAAAAACGCCCTG
GATCCGGGTTACCAGTCCGCACGGCGGCGGCGGTAAAGGCATGTTCTTTATCCCCGAAGTAGGCGAAGAA
GTAATTGTAGGGTTTGAAGGGGATAGTCCCATAAAACCATATATCATCGGCACCGTGTATCATGGCAAAG
CCAGCAACGCTTACAGCAATGCTGCCAATGATGTAAAAGCCCTGCAAACCCGCAGTGGCAATAAAGTTAT
TATGAACGACAAAGATGGCAGCGTGTTTGTGGAAGATAAAGATGGCAACAGCATGCTCATCGATGGAGCA
GGTAATATAACAGTCAAATCCAACAAAACGGTTTTGATCGACGCCACCAACGAAATCACGCTGAAGACCA
AAAAGATCACCATGCTGGCCGAAGACGAGATCGTGATGCAATCCAAAGTGCTCGATGCCCAATTCACCGA
AACCTCCACCATCTACGGTAAGAATGAAAACAATGTGTTGGCAAAAACTACCGTCACTATCGGTTCCGAC
AACAAAGTAGACATTGGCGGACTGGAGGTATCTACTTACGGCAAAACCAAAGTGGCGCTGGATTCAGAAG
GCTCCGTAGAAGCCAATGGTAAATTGATGACGACGATTGTGGGTGGGCAGGTGAAATTGAATTGTTGA