SecReT6
Protein ID: 375145902
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2599
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3227200..3227589 [-]
Producthypothetical protein
NoteHcp
UniProt IDG8TR25
KEGG IDnko:Niako_2599
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|375145902|ref|YP_005008343.1| hypothetical protein [Niastella koreensis GR20-10]
MSFIAKLKLDGEELNILHCAYRFTQATDGTGKPTAIPQGGSVTLVVESNGETGLFDWMISPTQTKSGTIT
FYRRDNMSKLKSLQFTDAHCVDYYETYDHNGDSPMRIQLTLSAKEVKLNESKFRNNWPQ
 
Nucleotide Sequence: 390 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3227589-3227200 Niastella koreensis GR20-10 chromosome, complete genome
ATGTCATTTATAGCAAAACTTAAGTTGGATGGCGAAGAGTTGAACATCCTGCATTGTGCATACCGTTTTA
CGCAGGCCACCGATGGCACCGGCAAACCAACCGCTATTCCCCAGGGCGGATCGGTTACCCTGGTAGTTGA
AAGCAATGGCGAAACCGGTTTGTTCGACTGGATGATAAGTCCAACCCAAACAAAAAGCGGCACCATTACT
TTTTATCGCCGCGACAACATGAGTAAATTAAAAAGCCTGCAGTTCACGGATGCGCACTGTGTTGATTATT
ACGAAACCTATGATCACAACGGTGACAGTCCCATGCGGATACAGTTAACACTCAGCGCCAAAGAAGTAAA
ACTGAACGAATCAAAATTCAGGAACAACTGGCCACAATAA