SecReT6
Protein ID: 375145904
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2601
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3228387..3229769 [-]
Producthypothetical protein
NoteTssC
UniProt IDG8TR27
KEGG IDnko:Niako_2601
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.50E-16, Aligned region: 123..248
DUF877 [PF05943], Evalue: 9.50E-16, Aligned region: 289..436
Phage_sheath_1 [PF04984], Evalue: 0.00044, Aligned region: 116..141
Phage_sheath_1 [PF04984], Evalue: 0.00044, Aligned region: 301..438
Protein Sequence: 460 a.a.     [Download]
>gi|375145904|ref|YP_005008345.1| hypothetical protein [Niastella koreensis GR20-10]
MSSESIKPAQQTALKEEKSLALQPVEQLENSVQGLAKFGGFDLLESAIDAVQNINPERKARKKIFLEENS
KKEERTALKKTLKLWLDVLQTSDDPAQMIQTCNDRSEVAGQVLKKNLKEAVKETGQLERSYRSVALFFKN
TESLKVKNVSVINADPDQVRDLDNTRFIDAIHNELTDNYDRLDLRNNYSLLILPGYLGSNKVIEKWARIA
YENKVMLVTDFENLDSPDDVMELFEAANLTGGDPYRSNVIMACNWLVGRGRFAEIGEEDDLMVPPSSALA
GKIYNTLMSQVTAGKKFGGINEVDGVRFDLKKSEIASLEKLGLIPMVKEYGKVMAFSAKTLFNGDNLGLQ
TYSVVRVFDYVTKVMMDFLNRRAFENFNASTRKELNGQIVKFLDGITGPNKLIENFTIKRFEQDPVQKDR
IYLDIHLKPYFPAKTFMIKLEGQKGDDSEVDWSSKYEQDK
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3229769-3228387 Niastella koreensis GR20-10 chromosome, complete genome
ATGAGTTCTGAATCCATTAAACCCGCCCAGCAAACGGCGCTTAAAGAAGAAAAATCCTTAGCACTGCAAC
CAGTTGAACAACTGGAAAACAGTGTACAGGGCCTTGCTAAGTTCGGCGGTTTCGATCTGTTGGAATCAGC
TATTGACGCTGTACAAAATATCAATCCCGAAAGAAAAGCAAGGAAGAAGATCTTCCTTGAAGAGAACAGC
AAAAAAGAAGAACGTACGGCACTTAAAAAAACGCTGAAGCTGTGGCTGGATGTACTGCAAACCAGCGATG
ATCCGGCACAGATGATCCAAACCTGTAACGACCGCTCCGAAGTTGCCGGTCAGGTATTGAAAAAGAACCT
GAAAGAAGCAGTAAAAGAAACCGGGCAACTCGAAAGATCATACCGCTCTGTAGCCCTCTTCTTCAAGAAT
ACAGAAAGCCTTAAAGTAAAGAATGTATCGGTGATCAACGCTGATCCGGATCAGGTAAGAGATCTGGACA
ATACCCGTTTCATCGATGCCATTCATAATGAACTGACTGATAATTACGACCGCCTCGATCTGCGTAATAA
CTATAGCTTACTGATTTTACCAGGTTACCTCGGCAGCAATAAAGTAATTGAAAAATGGGCCAGGATCGCC
TATGAAAATAAGGTGATGCTGGTAACCGATTTTGAAAACCTGGATTCGCCGGATGACGTAATGGAATTGT
TTGAAGCAGCCAACCTTACCGGTGGCGATCCTTATCGTTCCAATGTTATTATGGCTTGCAACTGGCTGGT
TGGCCGTGGCCGTTTTGCAGAAATAGGCGAGGAGGACGACCTGATGGTTCCACCATCGAGCGCACTCGCC
GGAAAGATCTACAACACCCTGATGTCGCAGGTAACAGCCGGTAAAAAATTTGGCGGCATCAATGAAGTAG
ACGGCGTTCGGTTCGACCTGAAGAAAAGCGAGATTGCGAGCCTGGAAAAACTGGGCCTCATTCCAATGGT
GAAAGAGTATGGCAAAGTAATGGCCTTCTCTGCCAAAACATTGTTCAACGGCGATAACCTGGGCTTACAA
ACATATTCGGTCGTGCGGGTATTTGATTATGTAACAAAAGTGATGATGGACTTTTTGAACCGTCGCGCTT
TTGAAAATTTCAATGCAAGCACCCGTAAAGAACTCAACGGGCAGATCGTTAAGTTCCTCGACGGCATTAC
CGGTCCCAATAAACTGATTGAAAATTTTACCATCAAGCGGTTTGAACAGGACCCTGTTCAAAAAGACCGC
ATATACCTCGACATTCATCTGAAACCGTATTTCCCCGCAAAAACTTTCATGATCAAGTTAGAAGGGCAGA
AAGGAGACGATTCAGAAGTGGATTGGTCTTCTAAATACGAGCAGGATAAGTAG