SecReT6
Protein ID: 375145905
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2602
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3229813..3230265 [-]
Producthypothetical protein
NoteTssB
UniProt IDG8TR28
KEGG IDnko:Niako_2602
PDB IDNA
Domain hit(s) vs Pfam LMP [PF04778], Evalue: 0.00011, Aligned region: 104..149
Protein Sequence: 150 a.a.     [Download]
>gi|375145905|ref|YP_005008346.1| hypothetical protein [Niastella koreensis GR20-10]
MSIEPYGIGGTEVKQDAFEAFADIPQNRVLLAEKLTQDPPVKPVITEGLTSIDDVFEHFKPKVDMTFETE
DGGMRRETLHFKGLADFGAKGIIAQSEYLGDVNMQQLQYQKIIKQLKTNKLLKQALANPETKEHIIKALQ
SLIQELDTAR
 
Nucleotide Sequence: 453 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3230265-3229813 Niastella koreensis GR20-10 chromosome, complete genome
ATGAGCATTGAGCCCTACGGAATTGGCGGCACGGAAGTAAAACAAGATGCCTTTGAAGCCTTTGCAGACA
TTCCTCAAAACCGGGTGTTACTCGCCGAAAAACTCACACAGGACCCACCTGTTAAACCTGTAATCACAGA
AGGCTTAACAAGTATCGACGATGTGTTTGAACACTTCAAACCAAAAGTTGATATGACCTTTGAAACGGAA
GATGGCGGCATGCGCCGGGAAACACTTCATTTCAAAGGACTGGCCGATTTTGGCGCCAAAGGTATTATTG
CACAAAGTGAGTACCTGGGAGATGTGAATATGCAGCAGCTGCAATACCAGAAAATTATCAAGCAGTTAAA
AACAAACAAACTGCTGAAACAGGCACTCGCCAATCCGGAAACAAAAGAGCACATAATAAAAGCGTTACAG
TCACTGATCCAGGAACTTGACACAGCCAGGTAA