SecReT6
Protein ID: 375145906
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2603
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3230590..3233076 [-]
ProductATPase AAA-2 domain-containing protein
NoteClpV
UniProt IDG8TR29
KEGG IDnko:Niako_2603
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.90E-48, Aligned region: 209..289
AAA_2 [PF07724], Evalue: 8.90E-48, Aligned region: 489..531
AAA_2 [PF07724], Evalue: 8.90E-48, Aligned region: 561..723
AAA [PF00004], Evalue: 5.90E-22, Aligned region: 141..173
AAA [PF00004], Evalue: 5.90E-22, Aligned region: 212..343
AAA [PF00004], Evalue: 5.90E-22, Aligned region: 567..683
ClpB_D2-small [PF10431], Evalue: 8.70E-19, Aligned region: 730..803
AAA_16 [PF13191], Evalue: 1.10E-15, Aligned region: 191..236
AAA_16 [PF13191], Evalue: 1.10E-15, Aligned region: 257..294
AAA_16 [PF13191], Evalue: 1.10E-15, Aligned region: 534..601
AAA_5 [PF07728], Evalue: 3.60E-15, Aligned region: 211..237
AAA_5 [PF07728], Evalue: 3.60E-15, Aligned region: 565..686
Sigma54_activat [PF00158], Evalue: 2.90E-09, Aligned region: 207..235
Sigma54_activat [PF00158], Evalue: 2.90E-09, Aligned region: 566..681
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 78..78
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 208..296
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 325..412
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 564..660
AAA_14 [PF13173], Evalue: 1.50E-07, Aligned region: 209..313
AAA_14 [PF13173], Evalue: 1.50E-07, Aligned region: 568..661
IstB_IS21 [PF01695], Evalue: 6.00E-07, Aligned region: 207..331
IstB_IS21 [PF01695], Evalue: 6.00E-07, Aligned region: 565..592
Arch_ATPase [PF01637], Evalue: 3.70E-06, Aligned region: 191..238
Arch_ATPase [PF01637], Evalue: 3.70E-06, Aligned region: 566..586
AAA_17 [PF13207], Evalue: 6.70E-06, Aligned region: 212..227
AAA_17 [PF13207], Evalue: 6.70E-06, Aligned region: 569..603
AAA_23 [PF13476], Evalue: 7.40E-06, Aligned region: 208..244
AAA_23 [PF13476], Evalue: 7.40E-06, Aligned region: 564..602
AAA_18 [PF13238], Evalue: 1.20E-05, Aligned region: 212..285
AAA_18 [PF13238], Evalue: 1.20E-05, Aligned region: 567..603
AAA_29 [PF13555], Evalue: 2.00E-05, Aligned region: 208..232
AAA_29 [PF13555], Evalue: 2.00E-05, Aligned region: 564..587
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 210..229
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 566..618
ABC_tran [PF00005], Evalue: 3.00E-05, Aligned region: 55..101
ABC_tran [PF00005], Evalue: 3.00E-05, Aligned region: 211..230
ABC_tran [PF00005], Evalue: 3.00E-05, Aligned region: 566..603
AAA_10 [PF12846], Evalue: 4.30E-05, Aligned region: 210..226
AAA_10 [PF12846], Evalue: 4.30E-05, Aligned region: 278..300
AAA_10 [PF12846], Evalue: 4.30E-05, Aligned region: 564..598
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 212..240
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 567..590
Clp_N [PF02861], Evalue: 7.60E-05, Aligned region: 21..56
RNA_helicase [PF00910], Evalue: 0.00011, Aligned region: 212..236
RNA_helicase [PF00910], Evalue: 0.00011, Aligned region: 566..587
Mg_chelatase [PF01078], Evalue: 0.00024, Aligned region: 208..248
Mg_chelatase [PF01078], Evalue: 0.00024, Aligned region: 564..588
T2SE [PF00437], Evalue: 0.001, Aligned region: 194..234
T2SE [PF00437], Evalue: 0.001, Aligned region: 563..635
ResIII [PF04851], Evalue: 0.0014, Aligned region: 192..234
ResIII [PF04851], Evalue: 0.0014, Aligned region: 272..297
ResIII [PF04851], Evalue: 0.0014, Aligned region: 537..587
AAA_25 [PF13481], Evalue: 0.0017, Aligned region: 43..104
AAA_25 [PF13481], Evalue: 0.0017, Aligned region: 212..234
AAA_25 [PF13481], Evalue: 0.0017, Aligned region: 402..432
AAA_25 [PF13481], Evalue: 0.0017, Aligned region: 565..594
AAA_19 [PF13245], Evalue: 0.0023, Aligned region: 210..229
AAA_19 [PF13245], Evalue: 0.0023, Aligned region: 568..588
MCM [PF00493], Evalue: 0.0027, Aligned region: 192..227
MCM [PF00493], Evalue: 0.0027, Aligned region: 328..398
AAA_28 [PF13521], Evalue: 0.0029, Aligned region: 212..258
AAA_28 [PF13521], Evalue: 0.0029, Aligned region: 566..584
AAA_30 [PF13604], Evalue: 0.0036, Aligned region: 208..237
AAA_30 [PF13604], Evalue: 0.0036, Aligned region: 508..546
AAA_30 [PF13604], Evalue: 0.0036, Aligned region: 568..589
AAA_24 [PF13479], Evalue: 0.0038, Aligned region: 211..228
AAA_24 [PF13479], Evalue: 0.0038, Aligned region: 566..589
Sigma54_activ_2 [PF14532], Evalue: 0.0042, Aligned region: 57..77
Sigma54_activ_2 [PF14532], Evalue: 0.0042, Aligned region: 206..229
Sigma54_activ_2 [PF14532], Evalue: 0.0042, Aligned region: 565..587
MMR_HSR1 [PF01926], Evalue: 0.0045, Aligned region: 212..287
MMR_HSR1 [PF01926], Evalue: 0.0045, Aligned region: 566..583
FtsK_SpoIIIE [PF01580], Evalue: 0.0058, Aligned region: 201..239
FtsK_SpoIIIE [PF01580], Evalue: 0.0058, Aligned region: 410..434
FtsK_SpoIIIE [PF01580], Evalue: 0.0058, Aligned region: 568..582
DUF815 [PF05673], Evalue: 0.0083, Aligned region: 205..237
DUF815 [PF05673], Evalue: 0.0083, Aligned region: 560..595
AAA_33 [PF13671], Evalue: 0.0093, Aligned region: 212..228
AAA_33 [PF13671], Evalue: 0.0093, Aligned region: 566..583
Protein Sequence: 828 a.a.     [Download]
>gi|375145906|ref|YP_005008347.1| ATPase AAA-2 domain-containing protein [Niastella koreensis GR20-10]
MTDQLLGTTISDSFKKMNHIAQAIARENMHPHIAPPHLLKALLHKDAGLQSLLQQLDKDIYYMEEWAEVR
METLPKATRLDDTLTANEPVKAVMEEADTIRVMTGSDELENLHVLAALSTPGVGFSYEQLKTFPIQRQEL
LQQSIADNTLNKITGIGNTNSTQKSAIHQALLKYCTHKNVRAKAGKIDPITGRDKEIRAMAEILGRRSKP
NVLIVGEPGVGKSALVDGFTLAIEEKKVPRFLEHAQVFELDNGALAAGASYKGEVEERLKNIIQEVKQFD
KAILFIDEMHVLMDKQGAMAGAANLLKPELARGELTVIGATTLEEYRKHIEKDEAFARRFDVIQVEEPDA
ATTFRMMQTIMPHYSKHHAITIEDETLQDTIRLAKRYVKDRRLPDAAIDLADHSMAALRLARDTGKQVVD
EMKAVFDAMQKESTLVDDWKWHYNQLRNKISPILWVAVQSETDPMQMTDANEIIHYLNLAYEALSERAAD
DRQVLNPSDVAAIVAHKTGIPIGKVQAQEKERLLKMDEILKQRVVGQDHAIRSISEAILESRAGLGKPGQ
PIGSFFFLGPTGTGKTELAKALADFLFQDENSMIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGLLINKI
RQQPYSVVLFDEIEKAHQSVFDIFLQIMDEGKLHDKLGKEGDFSNALIIFTSNIGSQYVVDSFNNKQVPS
SNQLMEIMSNYFRPEFLGRLTEICPFAPMTNEMVERILNIQLKGLYGSLEKQGITLQLTDTAKKQLAVLG
FAPQYGARPLAGVIRNNLRRPLSRKIISGEAGAAENTILILDADEQGNFLWNNTSAVL
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3233076-3230590 Niastella koreensis GR20-10 chromosome, complete genome
ATGACTGATCAATTATTAGGCACCACCATATCTGATTCATTTAAAAAAATGAACCACATTGCCCAGGCGA
TTGCCCGGGAAAATATGCATCCGCATATTGCACCGCCGCATTTATTAAAGGCGTTACTGCATAAAGATGC
CGGGCTGCAATCGTTGTTACAGCAACTGGATAAAGACATTTATTATATGGAAGAGTGGGCCGAGGTGCGC
ATGGAAACATTGCCCAAAGCCACCCGGCTCGATGATACGCTTACAGCCAATGAACCGGTAAAGGCCGTGA
TGGAAGAAGCAGATACCATCCGCGTAATGACGGGCAGCGACGAACTGGAAAACCTGCATGTACTGGCTGC
CCTGAGCACGCCGGGTGTAGGATTCAGTTATGAGCAATTAAAAACCTTTCCCATTCAACGGCAGGAGTTG
CTGCAACAGTCGATAGCAGACAATACACTGAATAAAATAACCGGCATTGGCAATACCAACAGCACCCAAA
AATCAGCCATTCACCAGGCGTTGTTAAAATACTGCACGCATAAAAATGTACGCGCCAAAGCGGGTAAGAT
CGATCCTATTACGGGTCGCGATAAGGAGATCAGGGCAATGGCCGAGATCCTGGGCCGCCGCTCAAAACCC
AATGTGCTGATCGTTGGCGAACCCGGTGTTGGTAAATCGGCACTGGTGGATGGGTTCACCCTGGCCATCG
AAGAAAAGAAAGTACCACGTTTTCTGGAACATGCCCAGGTATTTGAGCTGGACAATGGCGCACTGGCTGC
CGGCGCTTCGTATAAAGGAGAAGTAGAAGAACGCCTGAAGAACATCATCCAGGAAGTAAAACAATTTGAC
AAAGCCATTTTGTTTATCGACGAAATGCACGTGCTGATGGATAAACAGGGCGCTATGGCCGGCGCAGCTA
ATTTATTAAAACCTGAACTGGCCCGTGGCGAATTGACCGTTATAGGCGCTACTACGCTGGAAGAATACCG
GAAACATATAGAAAAGGATGAAGCCTTTGCGCGTCGTTTTGATGTGATACAGGTAGAAGAGCCGGATGCA
GCCACTACCTTCCGCATGATGCAAACTATTATGCCGCATTACAGCAAACACCATGCAATAACTATAGAAG
ATGAAACCCTGCAGGATACCATCAGGCTGGCGAAACGTTACGTAAAAGACCGCCGCCTGCCCGATGCAGC
TATTGACCTGGCGGATCATTCCATGGCTGCGCTTCGCCTGGCAAGAGATACCGGTAAACAGGTAGTGGAT
GAAATGAAAGCGGTGTTTGATGCCATGCAAAAGGAATCAACTTTGGTTGATGACTGGAAATGGCATTACA
ACCAGTTGCGCAATAAGATCAGTCCGATTCTGTGGGTCGCGGTTCAATCAGAGACTGATCCCATGCAAAT
GACGGATGCCAATGAAATTATTCACTATTTAAACCTCGCGTACGAAGCGTTGTCAGAGAGGGCAGCCGAT
GACCGCCAGGTACTCAATCCGTCAGACGTAGCCGCTATTGTAGCACATAAGACTGGCATTCCTATTGGGA
AAGTGCAGGCGCAGGAAAAAGAGCGGTTATTGAAAATGGATGAGATCCTTAAACAAAGAGTAGTAGGGCA
GGACCATGCCATCCGTTCTATCAGCGAAGCCATTCTGGAATCAAGGGCCGGGTTAGGCAAGCCTGGTCAG
CCAATAGGTTCTTTCTTTTTCCTGGGACCAACAGGTACAGGTAAAACAGAGTTGGCAAAAGCGCTGGCCG
ATTTTTTGTTCCAGGATGAAAACTCGATGATCCGGTTTGATATGTCGGAGTTTAAAGAAGAACACAGCGC
CGCCTTGTTATATGGAGCGCCTCCCGGTTATGTTGGGTACGAAGAAGGCGGCTTGCTTATTAACAAAATT
CGTCAACAACCATACTCAGTAGTGTTGTTCGATGAAATTGAAAAAGCGCATCAGTCGGTATTTGATATTT
TTTTACAGATCATGGATGAAGGCAAGCTGCACGATAAACTGGGGAAGGAGGGCGATTTCTCCAATGCACT
TATCATCTTTACTTCTAATATCGGCAGTCAGTATGTAGTGGATTCGTTTAATAATAAACAGGTTCCGTCC
AGCAACCAGTTAATGGAGATCATGAGCAATTATTTCCGGCCCGAGTTCCTGGGACGGTTAACAGAGATCT
GTCCGTTTGCACCTATGACCAATGAAATGGTTGAACGCATTCTCAACATTCAACTGAAAGGGTTATACGG
TTCACTGGAAAAACAGGGGATCACATTGCAACTGACCGATACAGCTAAAAAACAATTAGCAGTATTAGGT
TTTGCTCCCCAATATGGGGCGCGGCCATTGGCAGGGGTAATAAGAAATAATCTGCGCCGTCCTTTATCCC
GTAAGATCATCAGCGGGGAAGCAGGAGCTGCAGAAAATACTATTTTGATATTAGATGCAGACGAACAGGG
AAATTTCTTATGGAATAACACGTCAGCGGTGTTATAA