SecReT6
Protein ID: 375145907
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2604
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3233129..3234175 [-]
ProductPKD domain-containing protein
NoteTssP
UniProt IDG8TR30
KEGG IDnko:Niako_2604
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 6.80E-15, Aligned region: 67..103
PKD [PF00801], Evalue: 6.80E-15, Aligned region: 134..190
Protein Sequence: 348 a.a.     [Download]
>gi|375145907|ref|YP_005008348.1| PKD domain-containing protein [Niastella koreensis GR20-10]
MENKKIQLAYLDEKVILTMIIVALLGLIITGFKYKNYEHCFDFHIKAKANFYRTDEPIHFETDALYAKEF
QWDFGDNENSETNISSVVHAFNSPGEYTVALTINGTCTEYKTIYITRAPKLENPLLLPRFICPQQAEVGK
AVTFQDTTPGAHSWEWRFGETAVIDATASTASYVYKTPGLKTISLVLNNDPKQLGVCKVYVNDKAVAPSR
SNAHTPRSSGPSFVIVPARPQAPPLEEQNHPQPAVTEPPKPQGVNISKQELETKLRGVVNNYLTPENFSQ
YFCNNLNVPVSLNGTEITFTQFCTKLSSIKNDKKIKQLNVQQIKSSETNCLIGLNVSLKMKQGFLGIF
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3234175-3233129 Niastella koreensis GR20-10 chromosome, complete genome
ATGGAAAATAAAAAAATACAGCTGGCTTATCTCGACGAAAAGGTAATTCTCACCATGATTATTGTGGCCT
TGCTGGGTTTAATAATCACCGGGTTTAAATACAAGAACTACGAACATTGTTTCGATTTTCATATAAAGGC
AAAGGCGAATTTTTACCGAACGGACGAGCCCATCCATTTTGAGACCGATGCCCTGTACGCAAAGGAATTT
CAGTGGGATTTTGGCGATAACGAGAACAGTGAAACCAACATCAGTTCGGTGGTGCATGCCTTCAATTCGC
CCGGCGAGTATACCGTGGCTTTAACCATCAATGGCACCTGCACGGAGTACAAAACAATTTATATTACCCG
GGCGCCCAAACTGGAAAACCCGCTGCTGCTGCCGCGGTTTATTTGTCCGCAGCAGGCAGAAGTGGGTAAA
GCCGTTACCTTCCAGGATACCACCCCCGGCGCTCACAGCTGGGAATGGCGTTTTGGCGAAACCGCCGTTA
TTGACGCTACCGCTTCCACTGCCAGTTACGTATATAAAACCCCGGGCTTAAAAACCATTTCCCTGGTGTT
GAACAACGACCCCAAACAACTGGGAGTTTGTAAAGTATATGTGAACGATAAGGCCGTGGCGCCATCCAGA
TCAAATGCCCACACGCCCCGTTCATCGGGCCCTTCTTTTGTAATTGTGCCGGCCAGGCCACAGGCGCCGC
CGTTGGAAGAACAAAATCATCCGCAGCCTGCAGTTACTGAGCCACCCAAACCGCAGGGCGTAAACATCAG
CAAACAGGAACTGGAGACCAAATTGCGCGGCGTGGTAAACAATTATTTAACACCAGAAAACTTCTCGCAA
TATTTCTGTAACAACCTGAATGTGCCCGTAAGTCTAAATGGCACAGAGATCACGTTTACTCAATTCTGCA
CCAAACTCAGCTCTATCAAAAACGATAAGAAAATAAAACAACTGAACGTACAACAAATAAAAAGCAGTGA
AACCAACTGCCTCATTGGATTAAACGTGAGCCTTAAAATGAAACAAGGGTTCTTAGGAATATTTTGA