SecReT6
Protein ID: 375145909
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2606
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3234936..3235457 [-]
Producthypothetical protein
NoteTssO
UniProt IDG8TR32
KEGG IDnko:Niako_2606
PDB IDNA
Domain hit(s) vs Pfam Oscp1 [PF10188], Evalue: 0.00022, Aligned region: 44..155
YjcZ [PF13990], Evalue: 0.0091, Aligned region: 48..168
Protein Sequence: 173 a.a.     [Download]
>gi|375145909|ref|YP_005008350.1| hypothetical protein [Niastella koreensis GR20-10]
MPSVLNHKERNRAFLKFLFFFIISVWLIVGAIYFDMRIPYKENDVLREQVTRYRNQTIAQEKFVSSMDQA
KMLIDSLKQPGVNSMYLNQQIAAKLRELTDLQYKDSSMYSRMNKNVLDLYLRYQDATNKVVSMGDLPKQL
DDYKSKFEQTQRDLDQARRDIDLLRRASTAGGF
 
Nucleotide Sequence: 522 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3235457-3234936 Niastella koreensis GR20-10 chromosome, complete genome
ATGCCCAGCGTATTAAACCATAAGGAAAGAAACCGCGCATTTTTAAAGTTCCTGTTCTTTTTCATCATCT
CCGTATGGCTTATTGTTGGAGCCATCTACTTCGATATGCGCATTCCCTACAAGGAAAACGATGTATTGCG
CGAACAGGTTACCCGCTACCGCAACCAAACCATTGCCCAGGAGAAATTTGTAAGCAGTATGGACCAGGCC
AAGATGCTGATAGATTCCCTGAAACAACCCGGCGTAAACAGTATGTACCTGAACCAGCAGATAGCCGCCA
AATTGCGTGAACTCACCGACCTGCAGTATAAGGACAGCAGCATGTACAGCCGTATGAATAAAAATGTGCT
CGATCTGTACCTGCGCTACCAGGATGCTACCAATAAAGTGGTGAGCATGGGCGATTTGCCCAAACAGCTG
GATGATTATAAAAGCAAGTTTGAACAAACCCAGCGCGACCTGGACCAGGCACGCCGTGACATCGATCTGT
TAAGGAGAGCCAGTACTGCAGGAGGTTTTTAA