SecReT6
Protein ID: 375145910
SecReT6 ID923
T6SS typeiii
Gene symbol-
Locus tagNiako_2607
StrainNiastella koreensis GR20-10
Repliconchromosome [GenBank: NC_016609] [Browse all T6SS(s) in this replicon]
Location [Strand]3235492..3236673 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8TR33
KEGG IDnko:Niako_2607
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.0058, Aligned region: 22..50
DUF876 [PF05936], Evalue: 0.0058, Aligned region: 174..239
Protein Sequence: 393 a.a.     [Download]
>gi|375145910|ref|YP_005008351.1| hypothetical protein [Niastella koreensis GR20-10]
MQSNTEYLPVNWVDGMKINKTHFIAQDNAFTYRQAHTVSSFLNEHNYGLLPVFDRHHTSAKLFLSLDNEQ
TVHLRIQRCRAISRGGYVMEFDTDTALTGQQLSATIPGLQVPFSELKDRSAFYYVVLSIDPYERVPFGTA
DPKETPPRMPFTMPVYYLTLLPAQETSPLSLGQFQVPVGKVMVEDQAVRLVESYIPPCTAVNSHYELLEV
HAGLEQFFGQMELYALQIIQKIFQKKQQNELADAIFEICRNLSAFTATEFSNFKLSYIYQPPVFMITAVT
GMARLIKNTMDFYAGTSKDELISYCTEWCGVSQGELESAITTLCSYQYNHLDINDALDKVLQFTQIISSL
FSNLSRLEYIGKKKETGIFVKEQVLLPQTETAPAKKRRSFLAD
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|375143366|ref|NC_016609.1|:c3236673-3235492 Niastella koreensis GR20-10 chromosome, complete genome
ATGCAGTCAAATACTGAATACTTACCTGTGAATTGGGTAGATGGGATGAAGATCAACAAAACGCATTTTA
TTGCCCAGGATAACGCATTCACTTACCGCCAGGCCCATACCGTAAGCAGTTTTTTAAATGAACACAACTA
TGGGTTGTTACCGGTGTTCGACCGGCATCATACTTCTGCTAAATTATTCCTGTCGCTCGATAATGAACAA
ACCGTTCACCTGCGCATTCAACGCTGCCGGGCGATTTCCCGCGGCGGGTATGTAATGGAGTTTGATACGG
ATACTGCCTTAACCGGTCAGCAGTTATCAGCTACCATTCCGGGATTACAGGTACCATTTAGTGAGTTGAA
AGACCGGAGTGCCTTTTATTATGTGGTGTTAAGCATAGATCCATACGAGCGCGTACCGTTTGGTACTGCC
GATCCCAAAGAAACACCACCACGCATGCCATTCACCATGCCGGTATATTACCTCACCTTATTGCCAGCAC
AGGAAACCAGTCCGCTTTCGCTGGGACAATTCCAGGTGCCGGTGGGCAAGGTGATGGTGGAAGATCAGGC
GGTGCGGTTGGTGGAGAGTTATATTCCGCCCTGTACGGCAGTAAACAGCCATTATGAATTGCTGGAAGTG
CATGCCGGGCTGGAACAGTTTTTTGGCCAAATGGAATTGTACGCTTTGCAGATCATTCAAAAGATTTTTC
AGAAGAAACAGCAGAACGAACTGGCAGATGCCATCTTTGAGATCTGCAGGAACCTGAGCGCGTTCACCGC
CACAGAGTTCAGCAATTTCAAATTATCCTACATCTATCAGCCACCGGTGTTTATGATAACCGCTGTAACT
GGTATGGCGCGACTCATTAAAAACACTATGGACTTTTATGCCGGCACCAGTAAAGATGAACTGATCAGCT
ATTGCACCGAATGGTGTGGGGTAAGCCAGGGCGAACTGGAATCGGCCATCACCACTTTGTGCAGTTACCA
GTACAATCACCTCGACATCAATGATGCCCTGGATAAAGTATTACAGTTTACCCAGATCATTTCATCATTG
TTCAGCAACCTGTCGCGACTGGAATACATAGGCAAGAAGAAGGAGACCGGCATTTTTGTGAAAGAGCAGG
TGTTGTTACCGCAAACCGAAACCGCGCCGGCAAAGAAAAGAAGAAGTTTCCTGGCAGATTAA